CAZyme Information: KFA50897.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA50897.1
• CAZy Family: GH146
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KL651402|CGC2	47108.33	9.3632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651402:215366-216728(+)

Full Sequence      

MASGILPHQTHPRLALAAAFAAWKSLLLAIALGTALAADYDTSTSVFFDVVYGAGARVPA
LAHRLTRWDALYFVHAAHRGYVYEQEWAFGTGLPMVVRAVLGAARVLGVPLDGVSEPVTA
IAIAHISHLGAVLALYELTILLFQNRRLAFVASVLHVISPAGLFLSAPYAESPFACLSFL
GLLLFALSIQNGADGMTRHVTQVAAGAIFGLTTLLRSNGVLNGLLFAVEAVHCLLAFVKR
PGFHQVLHLVAPILGGLLVAAGFVAPQAVAWTIYCGTDIRTVETRAWCTRLVPSIYGFVQ
EHYWNVGFLRYWTPGNIPLFLLALPVITLLLRSGIEVSRDPFKALNSMLPVPSEPHRLFV
RTLAATQLILGIMAVTSYHVQIITRIASGYPVWYWWVANNLAKKEPSGWAWTTTVFMALY
GSIQGGLFASFLPPA

Enzyme Prediction     

No EC number prediction in KFA50897.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	20	435	1.8e-113	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.52e-39	65	435	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	9.17e-20	67	435	76	407	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64606.1|GT76	5.51e-168	4	435	2	427
UKZ87563.1|GT76	1.57e-166	4	435	2	433
QPC72356.1|GT76	2.23e-166	5	435	3	423
UKZ53459.1|GT76	1.04e-165	8	435	7	437
UKZ62611.1|GT76	7.33e-165	4	435	2	433

PDB Hits     

KFA50897.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	3.03e-164	5	435	3	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.91e-117	9	435	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	3.73e-87	6	435	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	4.67e-80	5	435	22	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.15e-58	20	435	11	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.024531	0.975429	CS pos: 37-38. Pr: 0.9387

TMHMM  Annotations     

Start	End
15	37
87	109
119	141
148	170
174	193
219	238
253	275
308	330
358	380
407	429