CAZyme Information: KFA50802.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA50802.1
• CAZy Family: GH132
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		59555.63	9.3144

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651403:6027-7619(+)

Full Sequence      

MSNGDRALRLLRLVASGWSSGANDARQLVPLGAGDERSTDGRRRASASATPATAFPDYAS
DNGSRADLEAASLRELSSTPTTLGSDTEAAPSPAPTSTPPSRGCFHRRPRKRSPPRRRRC
TMILYFLLLLVASYLVYFWRNEKARKVRWKPDPESELFSKRPLPPPLERMSITQYELPLR
TSGRHIVDGRGHRFKLASINWYGASDELFVPGGLDIQHRSVIARTIKRLGFNSVRLPYAD
ELVMLNPTILPHLVTANTDLAGLRAMDVFEAVVTALTDAGLAVIINNHITSATWCCGADP
CDAGWANDHLGNLCRVKQTENEWIEHWETVMSRFLDNPLVIGADLRNEVRGLWGTMPWSK
WAAAAERCGNHLLGMKSDWLIVVEGTESANDLSGAATRPVKLKVPNRLVYSSHIYGWSGW
GSRDGRFSQRSYASFVKTMRYNWGYLVENDTAPVWVGELGAPDHPSLGDAHYWQNMWRYL
KAVDADFGYWALNPRKPANNARERYSLIKDDWITPVVDYRMKDMVELMRQ

Enzyme Prediction     

No EC number prediction in KFA50802.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	186	498	6.9e-157	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	5.79e-27	222	494	29	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	4.16e-15	225	513	81	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ59514.1|GH5_24	7.64e-236	134	530	109	505
UKZ55077.1|GH5_24	6.26e-233	131	530	98	497
UKZ85745.1|GH5_24	7.88e-231	134	530	109	505
QYT00999.1|GH5_24	3.28e-230	134	530	100	496
QBZ62768.1|GH5_24	3.92e-222	133	529	14	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	1.12e-43	181	518	8	342	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	1.56e-43	181	514	8	338	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
3VVG_A	3.74e-24	185	514	19	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	8.93e-24	185	514	52	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	8.93e-24	185	514	52	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.55e-41	181	514	41	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	3.15e-41	181	514	49	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|C0HLA0|GH5FP_CHAOB	2.47e-29	170	512	22	379	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P50400|GUND_CELFI	1.76e-21	179	514	46	400	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P19487|GUNA_XANCP	1.99e-19	182	512	30	354	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000005

TMHMM  Annotations     

Start	End
120	139