CAZyme Information: KFA50489.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA50489.1
• CAZy Family: GH125
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		35971.50	9.6458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651425:293273-294319(+)

Full Sequence      

MHFAYPPRKSSNPLPFRPRSSKYSFLRRTRLRSILGIIGLCLFVLYFLTRPSRSAPYREH
VPSGNPPVVIVTVIDPTTYKNEYLDTIKENRELYAARHGYKTMIVKTFDYDTKGSPKSWS
KIMAMRHALTLYPDATYIWFLDQNAYIMDPTKSLEDQVLKPKKLESLMIKDYPVVPPDSI
IKTFTHLKGQNAQLVISQDLDGLVADSLVLKNGDWAKFLVETWLGPLYRSYNFQKAERHT
LEHIVQWHPTILSKLALIPQRTLASYTRTETGDVYQAGDFVVMFPGCKESGEKSCEAESA
SYLQKWRAAFESA

Enzyme Prediction     

No EC number prediction in KFA50489.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	66	292	7.5e-72	0.975609756097561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	4.03e-79	64	292	1	237	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI16093.1|GT34	8.28e-161	1	310	1	310
QPG93680.1|GT34	7.12e-155	1	310	1	310
UKZ69269.1|GT34	1.38e-154	1	310	1	310
UKZ96164.1|GT34	2.79e-154	1	310	1	310
UKZ78380.1|GT34	2.65e-152	1	312	1	312

PDB Hits     

KFA50489.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	6.71e-44	83	305	88	309	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	2.81e-33	75	287	115	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|P46985|MNN11_YEAST	5.77e-31	66	305	158	418	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q09174|GMA12_SCHPO	1.42e-28	75	304	115	348	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09681|GMH2_SCHPO	3.69e-22	59	287	89	328	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000010

TMHMM  Annotations     

Start	End
31	48