CAZyme Information: KFA49957.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA49957.1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	KL651482|CGC2	46016.77	3.8088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651482:255599-256912(-)

Full Sequence      

MHVSSIVLSGALAAGVSAQNYLGFNSGATLADRSAKFKEDYLAEFRTAQNLRGAPGKFNA
VRLYTNIQAYSESDPISAFEAAIETDTSILLGVWASGTNNIDNEIAALRAAIDQYGSDFT
DLVIGISIGSEDLYRVSETGVINESGVGAGPDVLVRFIEEYREAFADTPLADVPVGHVDT
WDVWGNSSNRAVIEAVDFIGVDEYPYYENDKGNDISNSGQLFDRAYQATLDAAGGKPVWV
TETGWPTSGPDWDEAEASIRNAKYYWNEVGCRRLFNQVPTFWYNLRDSNPDNEMKFAITE
NLSTTPMFNLTCPTTFQTPDADEEEEDDEDVRPSGSATTTVASTTTAAPTTSSTSGSGSG
SGSGSDEDDSDSDSGSGSGSESGSGSGSGTTPGAPSPTNSGSSEEVTPPASGAMSGKMLS
TMTYGGLALVAGVFALM

Enzyme Prediction     

No EC number prediction in KFA49957.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.67e-25	16	271	40	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.36e-07	178	289	157	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57324.1|GH17	8.66e-177	4	319	5	320
UNI15929.1|GH17	1.39e-174	1	318	1	319
CDP32718.1|GH17	1.90e-173	8	319	10	321
CAP65657.1|GH17	1.90e-173	8	319	10	321
VBB87201.1|GH17	1.90e-173	8	319	10	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.87e-18	58	287	59	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.25e-17	58	287	59	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	2.27e-99	21	312	20	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q2UUZ1|EGLC_ASPOR	1.56e-97	7	312	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	8.58e-97	7	312	6	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	7.35e-96	23	312	23	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	2.64e-94	11	312	10	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000406	0.999561	CS pos: 18-19. Pr: 0.9694

TMHMM  Annotations     

There is no transmembrane helices in KFA49957.1.