CAZyme Information: KFA49806.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA49806.1
• CAZy Family: PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		55077.99	9.0904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651488:12653-14218(+)

Full Sequence      

MGSSYSRWDLGGLGSHRRPSSHRRGRSASQAVMLNVPRRLRRRLVSLALLLFCLLNVLWL
VLPADSAVRLAVNFNSARLHNLIRNAAVDRDAWLRKPAPYAVDLGRDVAYLIKTGYGTRH
RIPAQQEAFSMAAGGAAPGEQAGRFLVVGDWTTVNETDALALGVEVHDAIKMVMETKIGP
DWQGHHRFRKYRSLQEAVESGDEAMANRLGQSFGWELDALKFIMGLELVYKQMPNKKWYI
ILDDDTYLITPTLKLILGHLDSRKPHYIGNAVGDFKARFAHGGSGILLSGEALRRLFSRA
DIVAKAYFDSLDETWGDRLVATTLQKLGIYLNERYCHHFNGEPPEITRISRDRFCSPLLS
FHGLRKIGAMEEVGHTLASIEKPVLWGDLWQYFGSYPIQELASQPVQHRQDHVGPGDEFI
KTWDRVETAEQCLRNCERSSKWCLAWTHDQQSKECRGSPWMVIGTGDAEQKDSGVNWKKM
APLVKQCS

Enzyme Prediction     

No EC number prediction in KFA49806.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	6.46e-05	219	300	68	163	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238532	PAN_AP_HGF	0.002	419	475	17	74	Subfamily of PAN/APPLE-like domains; present in N-terminal (N) domains of plasminogen/hepatocyte growth factor proteins, and various proteins found in Bilateria, such as leech anti-platelet proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97676.1|GT31	2.92e-200	33	488	1	454
CCT62550.1|GT31	1.98e-193	33	487	1	453
QGI76233.1|GT31	1.98e-193	33	487	1	453
QGI59018.1|GT31	1.98e-193	33	487	1	453
QKD47275.1|GT31	3.25e-192	33	487	1	453

PDB Hits     

KFA49806.1 has no PDB hit.

Swiss-Prot Hits     

KFA49806.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999743	0.000265

TMHMM  Annotations     

Start	End
44	63