CAZyme Information: KFA49470.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA49470.1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901	KL651502|CGC1	101463.68	5.0974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651502:78497-81414(-)

Full Sequence      

MLKFFRPKAASKADEPSQEKQPSRDSYGGVLSDASSGYSPAGAYDDEFRYRTMINYLYRK
VVSSGWIPARSPNQDECLGVLMRRSRGHYISAPEPVHHDLLGAVIRLNVIVAFTMQPEIL
DGIISSLSPGQTELRLKDGSQLQVIDSLAIAHPTSVKKFQYACICRQERLILVWQDDLQK
IIPQALSIEEKLLSLVWGGARLPFSLRQGTMTPSAYSSEIPSPYGLASPATEKANPMVFA
DESVEELDSDLAIERPESLARPVVRASSFFVGLSLTLGITLICGVFVGRIISECLLDESW
TRLALVVPIPLLMLVSLFFFQVIFTNLFQMMGPIGSINANTRFYSAQKPCLKRAQLDGFE
PPKVTIQMPVYKEGMDSVIIPTIRSLQAAISYYESHGGSANIFVNDDGLRAGIPEEEVRQ
RREFYHDNNIGWVARPKHNGDEGYVRKGKFKKASNMNFALNVSQKVEEYLQEMVDAKIGA
DGHGMIDENEEEEMYQIALARVLQENPLAMAEGDIRVGEVILIVDSDTRVPVDCLMYGAA
EMFLSPEVAIIQHSTGVMQVTRDYFENGITYFTDLVYSSIRFSIGSGEVAPFVGHNAFLR
WQAVQDVGREEENGFIAYWSESHVSEDFDISLRLQMNGNVIRIATYHNCEFKEGVSLTIY
DEIARWQKYAYGVSEMMFHPLYMWPYRGPFTRLFYTFLFSNIMYSSKISIMAYMCSYFAL
GSALLLSVTNYFIVGWFQDDISDAYLQSWNVLLSLIVVFNAFSNVALACMRYRTGERSFL
GSLFENFMWSPMMTCFFGGLAFHITVALLAHLLHIDMQWGATSKEKEDSNFFQEIPRIFK
TFKYMYITLTIIVGGMIYLGAFAPADWAISDFTAIVPLALSLGFHALVPLALNPSLMVFN
Y

Enzyme Prediction     

No EC number prediction in KFA49470.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	520	734	6.5e-50	0.8934010152284264

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.68e-49	520	726	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.30e-11	312	767	4	374	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.65e-11	366	627	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
184755	hmsR	0.003	519	704	157	343	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
236882	PRK11204	0.004	508	642	130	250	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI18966.1|GT0	0.0	40	901	42	905
QLI74022.1|GT0	0.0	39	901	35	902
ANH56600.1|GT0	0.0	44	901	44	909
QUC19563.1|GT0	0.0	44	901	49	911
ATY61836.1|GT0	0.0	44	901	54	917

PDB Hits     

KFA49470.1 has no PDB hit.

Swiss-Prot Hits     

KFA49470.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000012

TMHMM  Annotations     

Start	End
269	291
303	325
712	734
746	768
788	810
842	864
874	896