CAZyme Information: KFA49260.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA49260.1
• CAZy Family: CE3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31097.82	5.7836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651513:50871-51807(-)

Full Sequence      

MVLFSLLYVAFSAAIAAAASLQRVTNFGNNPTGINMHIYVPDRVAADPAIIVALHPCGGN
GPQWFSGTRLPSYADSNGFILIYPETPNMSNCWDVHSPASLTHGSGGDAAGIISMVTYTL
QTYDGDAARVYVMGFSSGGMMTNVMAGSYPEVFEAGAAYSGTAHACFAGAPSATPFSPNQ
TCAQGLSHTPEEWGNLVRNSYPGYTGRRPRMQIWHGMADTLVRPQCASEALKQWSNVLGE
SFTRNATGVPSGQWTQSLYGDGTRLQGFFGQGVGHEAQINEDTLLQFFGILS

Enzyme Prediction     

No EC number prediction in KFA49260.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	34	191	5.9e-24	0.5947136563876652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	3.17e-42	36	252	1	212	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.58e-22	27	180	40	207	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.96e-21	38	257	5	218	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	2.42e-05	71	161	7	97	Prolyl oligopeptidase family.
223489	DLH	6.57e-05	33	182	11	159	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU88756.1|CE1	5.13e-163	10	292	10	292
QBZ57428.1|CE1	1.03e-162	5	292	5	292
VBB78227.1|CE1	2.09e-162	5	292	5	292
CDP27505.1|CE1	1.46e-158	5	292	5	314
CAP70910.1|CE1	1.46e-158	5	292	5	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.10e-79	18	289	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	6.17e-155	5	292	5	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	1.62e-152	5	291	5	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	2.63e-94	18	290	18	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	5.14e-93	15	292	15	293	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|Q96W96|AXE1_ASPFI	6.50e-82	18	289	29	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000349	0.999625	CS pos: 18-19. Pr: 0.8645

TMHMM  Annotations     

There is no transmembrane helices in KFA49260.1.