CAZyme Information: KFA49114.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA49114.1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		71503.60	6.7695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651531:4633-6733(-)

Full Sequence      

MWPFSIFPERSPADVNGKTYDYVIVGCGTAGCVLASRLSQDPSVSVLLLEKGRVQDSIIL
RIPLMSQNLGMGEGLQVQDNRWTETMPGANGRRNQLYGGESIGGGSRINAMLWTRGPPAD
FASWAEMGFDGWSWDKVEPYFRKLENAVAHPESKSRGHDGPIELRRIEFPFQWNSFLEKA
ARKIGLPIEKDCNDPEAPAIGYFPLDVATNSRGERVSAFTAFLNKELALQRQDRLTVCTG
VVASRLEVGSRRGLVTGVELKPARGKGDAQRNFVNATREVIICSGAICSPQLLLLSGIGP
KTSGDEIGIPLIKELPAVGATFSDHYSFPIMLELPKKETLHILESIWGLWYIIIWLLFRT
GLLSMSATSTSVFFRTTAIDENMQVKARDADGTDNLDASKSRNTPDVEIMLMPINSLERG
APGHSVFSFYPTLVQPHGKGRIEISSRDPLAHLRITYPMFVDNRDLVSARKAVRFTMRLA
QEFQNSGYPDPAPFAFAPGNKPDILKEYEKVARTDYEGRRVGTLAFTTTGIEAAPEKMHV
EVKPSNNKSWRDVTDDEIDDYVRRVAHTSLHYSCTCPMSNDDKTGVVDQKLLIHGFKNLR
IADASLFPKITSGHTMAPVMMIAARCADFIKETWQLDISDDLNP

Enzyme Prediction     

No EC number prediction in KFA49114.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	18	632	5.2e-141	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.62e-91	17	632	5	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.06e-90	18	631	4	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.99e-31	436	626	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.85e-30	85	326	10	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.85e-18	5	324	38	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92880.1|AA3_2	1.16e-203	1	635	1	616
QBZ58631.1|AA3_2	2.79e-189	2	635	3	657
UKZ47954.1|AA3	4.56e-167	28	635	1346	1915
VBB80495.1|AA3_2	6.94e-135	7	632	50	670
CDP28838.1|AA3_2	4.74e-132	8	632	51	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	8.33e-52	15	627	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.08e-51	11	627	15	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	1.41e-51	11	627	75	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.17e-51	15	627	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	2.98e-51	15	627	3	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.23e-66	20	631	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	2.36e-62	16	631	3	536	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|A0A3B1EFP9|STR4_STRTC	3.68e-62	18	631	34	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q13NG7|BETA_PARXL	1.24e-61	20	631	6	533	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|B2TCJ8|BETA_PARPJ	2.39e-61	20	630	6	532	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999848	0.000207

TMHMM  Annotations     

There is no transmembrane helices in KFA49114.1.