CAZyme Information: KFA48556.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA48556.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	KL651548|CGC2	77965.72	6.2654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651548:504191-506636(-)

Full Sequence      

MESQGSTSHPGRSRRAQTGGYLPIEDYGMVGNMHTCALIGIDGSVDFMCWPDFDSPSVFG
RLLDKQKGGHFSIAPPANFVCTTKQQYLPSSCILHTRYIHEDGVVDLVDFFPRPESAQVL
TKGYKHSAFRESVRVQRELKRWLVRRVECIRGSMTLDIEIFPAFGYGKDEHVTHIYRGTH
TPEQDESKVASFHSRDTKLQLDVAVDVGEVEGDAKRPAICFKREKRPGMQGDGIVGQIKI
FEGQAISFVLRNDIEDHITKNITIDDVDAQQHSTQIFWHNFISQSKYEGRWREVVSRSLM
ILKMMTYEPTGAIIAAPTFSIPEEIGGVRNWDYRYSWVRDSSFTIYILLRMGFKAEADAY
MDFIMDRLENSRAPDGGLPIMFTIRGETDIPEVTLDHLEGYRGSSPVRIGNGAAFHKQFD
IYGELMDGIYLYNKYGKPVPWDTWVAVRKMLDYVLTIMHEPDMSIWEVRNNKQHFTYSKI
MLWVAFDRGLRLADKRCFPCPSRDKWMQARDELYEQIMEKGYNSDMQCFVQSYENRTVLD
SSILIAPLVFFISPCDPRFTNTLDRILLLPDKGGLTSTGLVYRYDTEVSHDGVGGREGAF
SMCTFWLVEAMTRASVYEPKYLVRAVNLFENMLGFSNHLCMFSEEIARTGEQLGNTPQAF
SHLALISAAFNLDRVSKGEGDSR

Enzyme Prediction     

No EC number prediction in KFA48556.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	292	669	2.7e-80	0.9916897506925207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	1.34e-123	20	673	12	605	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	8.79e-77	289	670	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	4.36e-15	297	675	260	616	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99361.1|GH15	0.0	1	677	1	675
SCB64185.1|GH15	0.0	1	677	1	675
CEI64868.1|GH15	0.0	1	677	1	675
QKD47688.1|GH15	0.0	1	677	1	696
QPC75602.1|GH15	0.0	1	677	1	675

PDB Hits     

KFA48556.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	2.50e-205	21	675	14	642	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|P71741|TREH_MYCTU	2.49e-111	21	682	51	669	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|A0R0W9|TREH_MYCS2	7.61e-110	21	682	39	657	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|Q978S7|TREH_THEVO	3.62e-99	20	675	26	613	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
sp|Q9HLE2|TREH_THEAC	3.68e-92	38	677	2	578	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KFA48556.1.