CAZyme Information: KFA48340.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA48340.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	KL651549|CGC2	46098.42	2.9792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651549:22380-23657(-)

Full Sequence      

MYRYAILAAAVPMVAAHGFISSPPPRQPGEAYGAACGAQALNQQAADINGNVQGIMQVID
ARTISDDCNLWLCKGFLLEDPSLVQSYTLGQTIDFEINIAAPHTGVANVSVVRTSTNSII
GAPLIEFENYASTATGVDPSNRAFSVTLPEDLEGQCTTAGDCVLQWWWDAADINQTYESC
VDFTVAGSGSGSPAPAPSVSTPVPSATAPAVTTAITPQPTSTPIEEPIEEDDECPADDED
DEDEEPVEEDDECPADDEEEEDEEPIEDDDECPADDEEEEVEEPIEEVEEPVEEDDECPA
EEEDDESGDVDPDEEYDGVDVDEDDECPADEEEEEEEPIEEEDDECPAEDDEEEEPIEEE
DDECPAEEEDEEEEPIEDDDECPAEDEEDDYEETLPVVTSAGIYERAPATTLATVVRKAV
ATAAF

Enzyme Prediction     

No EC number prediction in KFA48340.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	17	183	1.7e-64	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	5.68e-10	17	183	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
225932	COG3397	2.67e-04	14	217	27	238	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60424.1|AA16	8.77e-82	1	185	1	184
UPK89094.1|AA16	4.23e-81	3	188	2	187
QKD50697.1|AA16	3.79e-79	1	188	1	189
CEI38513.1|AA16	9.95e-79	1	188	1	188
QGI62665.1|AA16	2.50e-78	1	225	1	225

PDB Hits     

KFA48340.1 has no PDB hit.

Swiss-Prot Hits     

KFA48340.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000317	0.999649	CS pos: 16-17. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in KFA48340.1.