CAZyme Information: KFA47906.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA47906.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895	KL651583|CGC1	97164.26	4.3664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651583:12499-15335(-)

Full Sequence      

MGIGTVTGVLTGLLALGVAAPTEQKRQADTEYYVPPYYPAPYGGWVDDWRDSYDRARALV
DRMTLAEKTNITGGTGIFMGMFPRSLLKGVEKIIANVAQGERCNGNTGSALRVGFPQLCL
NDAANGIRQTDNVTVFPDGITVGATFDKTLMYERGAAIGQEGRGKGVNVWLGPSVGPLGR
KPKGGRNWEGFGSDPVLQGVGAYQTIRGVQDQGMIATIKHLIGNEQEMYRMYNPFQYAYS
ANIDDRTLHEVYLWPFAEGVRAGVGAVMTAYNAVNGSASSQHPYLINGLLKDELGFQGFV
MSDWLSHMSGVASAIAGLDMDMPGDTQIPLFGNSYWMYELTRSTLNGSVPMDRLNDMATR
VVAAWYKMGQDSGYPTVNFDTNSDTREGPLYPAAWPDSPTGVVNEFVQVQADHDVIARQI
AQDAITLLKNDDNILPLSTSRPLKIFGTDAQTNSRGPNACPDRNCNEGTLGQGWGSGTVD
YMYLDDPITALRERASNVTFYNTDRFPSVPAPTEEDIAIVFISSDAGENSYTVEGNHGDR
DASRLFAWHNGDKLIQDAAARYSNVIVVAHTVGPLELEAWHDLPSVKAVLIAHMPGQEAG
QSLTNILFGDASPSGHLPYSTTYRENDMPDSVTNLIDFAFLNQPQDTYSEGLYIDYRWLN
REGIAPRYAFGHGLSYTTFSYSAAISKVTQLTTTPPARGPKEGILEYDEEIPAAAEAVQP
AGFGRVWRLIYSWLSESDANAALAAGESGTYPYPPGYSTTQRPGPRAGGGEGGNPALYDV
AYTISVTVENTGSDYAGKASVQAYLQFPEGIDYETPIIQLRDFEKTDELAPGESQTVEIT
LRRKDVSVWDVVLQDWVVPAVDGGYRVWIGAASDDLGTVCNVETLECESGVTGPV

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	323	3.3e-61	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.04e-49	63	440	1	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.95e-44	425	656	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.23e-39	112	875	101	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	9.85e-38	112	361	63	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.87e-29	134	711	112	670	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ93663.1|GH3	0.0	9	895	17	892
BAP59015.1|GH3	0.0	3	895	10	895
QUC22443.1|GH3	0.0	13	893	17	912
QYS94687.1|GH3	0.0	6	895	14	895
QPG97079.1|GH3	0.0	3	893	8	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	4.82e-210	35	876	7	831	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5NBS_A	8.88e-206	21	876	7	850	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6SZ6_A	1.45e-204	36	876	6	829	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	1.21e-198	33	858	6	816	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	1.52e-197	10	876	5	845	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UN12|BGLF_ASPOR	0.0	10	882	10	859	Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglF PE=3 SV=1
sp|B0Y7Q8|BGLF_ASPFC	0.0	24	882	30	862	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|B8NP65|BGLF_ASPFN	0.0	10	882	10	859	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1
sp|Q5B6C6|BGLF_EMENI	0.0	15	882	18	861	Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglF PE=3 SV=2
sp|Q0CI67|BGLF_ASPTN	0.0	5	882	9	860	Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.092319	0.907678	CS pos: 19-20. Pr: 0.8407

TMHMM  Annotations     

There is no transmembrane helices in KFA47906.1.