CAZyme Information: KFA46943.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA46943.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	KL651630|CGC1	52151.08	8.7233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651630:219926-221751(-)

Full Sequence      

MATHTESPDYIVVGGGTSSLVTASRLSEDPAYQTVTQPGLGGRSISEPQGKVLGGSSATN
CQAFIDPSQAGIDAWAKLGNPSCIWETLAPAYKKLHTLIPPADQATLGHLGIDWIDCKYR
GVSRSVEVSFPSVIQNPLCKGRINAFVNLDKATTTDSKLSWSAYGQTLLQSPNVQVITGA
RLHRLLLAQNASGEFKATGVEASVEDSKTQTYSSSREIIVAAGAFNSPKILELSGIRDKR
LFEVVDGINTGYPLMRQEPEALSLAQKLYIEHRAGSFTVGGTRSHAFMPIPDAALTKLLG
LPVPENFQAEILRESISDNQRNYEKVVRSILKDPNEASAAWFLFLAQANLHEGSKSFIGT
NFLPQNFASIGCSRSRPLSRVSTHVSSADVTADPIIDPQYFSHLAGLEIMARHSQALEGL
RQSKALAHYFKPEGVRNHKVAHKIGSRDGAKKYILVTATTTIPYLRYCSHAAQRECRSSW

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	31	240	1.1e-37	0.3961267605633803

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.29e-33	1	462	1	473	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.58e-27	3	239	1	275	choline dehydrogenase; Validated
366272	GMC_oxred_N	6.10e-17	9	240	2	206	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL52568.1|AA3_2	1.27e-104	9	461	13	538
CAK46356.1|AA3_2	6.88e-104	9	461	12	537
BCS02826.1|AA3_2	8.65e-98	9	461	12	537
BCS14479.1|AA3_2	8.65e-98	9	461	12	537
QSS49637.1|AA3_2	6.03e-95	9	460	11	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.89e-21	4	401	2	443	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.19e-17	9	250	3	298	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.20e-17	9	250	4	299	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.71e-17	9	250	42	334	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	2.91e-16	10	241	8	288	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	7.69e-27	9	426	15	527	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.46e-26	7	403	39	515	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.52e-26	9	411	15	504	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.52e-26	9	411	15	504	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.83e-23	6	440	45	537	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KFA46943.1.