CAZyme Information: KFA46434.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA46434.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
980		111143.92	6.0189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651651:170448-173451(+)

Full Sequence      

MRSTTGLSWKWTALVCLFGTLLCFITPAASVKEHDFKKCHQSGFCKRNRDFADNAISESS
TWISPYNVLPDSAAFQDGQLQATILKTINSNGETVRLPLTFSFLKSGLARVTLDEEKRQK
KDIELRHNSQARKERYNEAEKWVIVGGLDLDKEAVAVHQDNTQINVKYGQDGKHEAVIKF
SPFEVEFRRDGVSHVKLNDRGLLNMEHWRPKIEKTSPEKSEGETNDGESTAEADAANGED
ESTWWDESFGGNTDTKPRGPESIALDVSFLGYEHVYGIPEHTGPMSLKQTRGGDGNFEEP
YRMYNADVFEYILDSPMTLYGSIPFMQAHRQGSSVGVFWLNAAETWVDIVKTKDSVNPLS
LSKSAKTSTRTHWISESGILDLFVFLGPTPKDLTTKYGELTGYTALPQEGAIGHHQCRWN
YVSDDDVKDVDRKMDKFKIPYDVIWLDLEYTDDRKYFTWEPNMFADPYSMGQQLDSHGRK
LVLLIDPHIKKLDDYTVSKQMVSQELAVLNKDGNIFDGWCWPGNSNWIDCFNPKALEWWK
TLFKYDFFKGTMPNTFIWNDMNEPSVFNGPETTMPKDNLHYGGWEHRDVHQLNGMTFHNA
TYHAMLSRSKGELRRPFVLTRAFYAGSQRLGAMWTGDNQADWGHLAASLPMVLNQGISGF
PFAGADVGGFFGNPDKDLLARWYQAGAFYPFFRAHAHIDARRREPFLLGEPYTSIATAAL
RLRYSLLPAWYTAFYHANKDGSPIVRPMFWTHPSEEGGFAIDDQLFVGSTGLLAKPVVEQ
GKESADIWIPDDEVYYDYFTYNVLKTQRGKSITVDAPLDRIPLLLRGGHIFPRRDTPRRS
STLMKFDDYTLVVSVAKSGAAEGELYVDDGDSFEYEQGQYIHRKFMLDKGTLTSVDAEGR
EPGSVKPKTWLTAMKEVYVDKIILVGAPSTWNKQEVQIESEGRTWTVRAQYHPADKGRAA
YVTLGHVGARIGDDWTIKLS

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	383	830	3.2e-145	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	383	830	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	402	872	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	1.61e-176	178	930	60	765	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	5.15e-123	402	741	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	6.74e-106	388	881	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI18608.1|GH31	0.0	1	978	11	978
UPK94256.1|GH31	0.0	1	980	1	963
QLI66316.1|GH31	0.0	1	979	1	973
CZS84696.1|GH31	0.0	1	980	1	963
CEF87825.1|GH31	0.0	1	980	1	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	31	977	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	31	977	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	1.20e-241	13	979	14	942	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	2.82e-240	31	979	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	2.91e-240	31	979	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	3.49e-285	33	947	28	907	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q9FN05|PSL5_ARATH	5.05e-251	20	979	9	920	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q94502|GANAB_DICDI	1.04e-247	10	926	3	897	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|B9F676|GLU2A_ORYSJ	3.92e-241	26	980	23	919	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q4R4N7|GANAB_MACFA	6.16e-241	10	979	14	943	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000333	0.999668	CS pos: 30-31. Pr: 0.9678

TMHMM  Annotations     

Start	End
7	29