CAZyme Information: KFA46157.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA46157.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48938.22	6.8353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651667:59306-60718(-)

Full Sequence      

MKVSPIVAFMASLAGCVSAVRVTETQSWDIGTDIQGSERLNGVSYQEDVLLTFGDYQYVT
FYSTAPAGYNNHYVNVGRRRVNPSVGTWQYLTLTDYTQRTMDGHNMISMGISGDGRIHLS
FDHHDVPINYRVSNSGVALNPPSQWTASLFGPVQHSLTGSTGPWTPLTYPRFQPINNGDL
LLEFRIGQSGSGDSYIHRYSSSTGRWQAYGQYLQGDNNNAYINGLDYFNGRLYTSWTVRE
TPDANTNHDLYFAYSDDAGQTWRDTNGTSLAKPISAERPIVWRVGQNSQMVNQEGQVIDS
RGRFHVLMRDNNSGQQRYQHYLRDTNGRWTKNAINPGDLSGPLLYAPRGKFAVDASGDTL
FALLPDEPILQTKIYVATAGASFRDWTLLATIPNAQSEPLFDAQRLRASNVLSVFSRQGG
PFPDRKVQVWDFRLDFS

Enzyme Prediction     

EC	4.2.2.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	40	335	2.1e-95	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	1.71e-72	56	331	1	268	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI70604.1|PL42	2.78e-233	1	435	1	437
UPL03481.1|PL42	1.60e-232	6	436	7	438
SCB65023.1|PL42	4.15e-228	1	435	1	437
QGI94760.1|PL42	1.19e-227	12	435	12	437
QGI63878.1|PL42	1.19e-227	12	435	12	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	4.67e-227	22	435	5	420	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	7.69e-226	22	435	5	420	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	1.17e-225	22	435	7	422	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MVH_A	5.80e-37	40	415	35	400	Glycoside Hydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]
5MUM_A	2.15e-36	40	415	40	405	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A109PTH9|UL24S_ALTSL	5.79e-08	102	274	150	366	Ulvan lyase, short isoform OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_107 PE=1 SV=1
sp|A0A0X9SHN5|UL24S_PSEXP	7.25e-07	102	274	150	366	Ulvan lyase, short isoform OS=Pseudoalteromonas sp. (strain PLSV) OX=1547444 GN=PLSV_3875 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000173	0.999826	CS pos: 15-16. Pr: 0.8840

TMHMM  Annotations     

There is no transmembrane helices in KFA46157.1.