CAZyme Information: KFA46108.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA46108.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	KL651667|CGC5	90071.02	5.5813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651667:211602-214156(+)

Full Sequence      

MVGLIKLYLLASASLAGTAVAQNNTSDAYFEELERFWSYGRSPPVYPSPETRGRGDWAEA
HAYARNLVSQMTMEEKVNLTYGYDAPVNGCNGRLGSVPRLGFKGLCLNNAGNGVGGTEGT
NAYPAALHVGASWNRQLAYDRALHMGREFKRKGANVALGPAPGPLGRVPKGGRNWEAPSN
DPYLSGMITYETTVGLQKSVMACVKHIVGNEQETSRKAPRKFENDPSNIHSHNASVSSNI
DDKTMHELYLWPFYDSIRAGAGSVMCAYQRVNNSYSCQNSKVLNGFLKEEMAFEGFVVSD
WFEHKSGVGSANAGLDVVMPVAPLWQDGMLVEMVRNGSVSEARLDDMVTRVVAATWRFAD
FEPGTGIPVNLTLPHEFTDARDPSSRGTIFQGAVEGHVLVKNVDHALPLRKSKFLSIFGY
DAVANMRHSAEAAGFNMWKMGLAGTHQHLNGSTFTNEMLDWLFSSSVEQTETGPAIALNG
TMTTGGGSGASIGDNVDAPLDAFRRQAYEDGTMLAWNVQDPAPIVNKASEACLVFINAQA
SESWDRKNLTDAYSDNIVTTVASQCANTMVIIHAAGIRLVEAFYDHPNVTAIVLGHLPGQ
DSGRALVEVMYGKQSFSGRLPYTVAKQESDYGVTLDPDFPSDETPYYPQSNFTEGVYIDY
KHFDQYNITPRFEFGFGLTYTEFEYSNLEVYINRNATLSYLPPNVDHVLPGGIASLWDKV
AEVRVTVANVGDVAAAEVAQLYLGIPNGPRKVLRGFHKQLINVGSDAVFTFPLTRRDIST
WDVNTQHWVVQSGTYEVYVGKSVLDIQLTDSFVVGQNNSSLRI

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	96	320	1.1e-51	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	4.92e-35	398	660	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.64e-33	123	807	120	755	beta-glucosidase BglX.
395747	Glyco_hydro_3	3.17e-30	111	351	77	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.66e-23	62	770	51	730	Probable beta-xylosidase; Provisional
405066	Fn3-like	2.80e-21	737	802	1	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ64236.1|GH3	0.0	6	814	5	809
EHA46981.1|GH3	0.0	6	814	5	809
QRC93194.1|GH3	0.0	7	815	8	819
BCS11496.1|GH3	0.0	11	814	10	806
BCR99188.1|GH3	0.0	11	814	25	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	6.86e-164	3	808	4	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	2.09e-163	39	802	1	825	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	2.04e-154	42	816	7	842	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5NBS_A	4.34e-154	38	810	16	854	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
5FJI_A	3.61e-152	42	802	6	830	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D122|BGLM_NEOFI	5.63e-274	9	814	13	769	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	1.05e-271	9	814	13	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|B0XPB8|BGLM_ASPFC	2.98e-271	9	814	13	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1
sp|A5ABF5|BGLM_ASPNC	2.91e-265	7	814	8	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	2.98e-263	10	814	11	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000452	0.999524	CS pos: 21-22. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in KFA46108.1.