CAZyme Information: KFA46002.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA46002.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36345.26	4.0142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651674:33520-34619(+)

Full Sequence      

MRLSSSFLVLTAASAGLTKPTKRDGEFLWTGINESVGEFGEALPGELNTDYRWPDAAAID
TLHGLGMNTFRVAFKMERVIPETLTGTINETYFSGLEETVNHITSLGAYAVLDPHNYGRY
YGEIITDTDGFGAWWTTVASRFVDNELVIFDTNNEYHTMENSLVRDLNQAAIDAIRGTGA
TQYIFVEGNAWSGAWSWVSSGNGDALVDLTDPEDKIIYEMHQYLDEDSSGTHTECVSSTI
GVERVTEATQWLRDNGKRGIIGETAGAVNPTCIAAVTGELQYLLDNSDVWTGWLWWAAGP
WWADYMYSLEPPSGPAYVGLLSDIQPFIGA

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	306	1.4e-110	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.12e-67	36	299	8	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.04e-17	11	311	29	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK98089.1|GH5_5	9.91e-169	1	330	1	333
QPC67358.1|GH5_5	1.66e-158	1	330	1	335
QPC76126.1|GH5_5	1.66e-158	1	330	1	335
CEF73786.1|GH5_5	1.66e-158	1	330	1	335
CZS77052.1|GH5_5	1.66e-158	1	330	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GZJ_A	2.53e-132	27	328	3	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	1.23e-130	27	328	4	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]
5I77_A	6.35e-130	27	328	2	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	5.55e-129	27	328	4	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	5.75e-129	27	328	5	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BDU5|EGLA_EMENI	8.43e-145	8	330	4	325	Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglA PE=1 SV=1
sp|A1DME8|EGLB_NEOFI	7.89e-139	1	329	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	1.43e-132	1	328	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
sp|A2QPC3|EGLB_ASPNC	1.43e-132	1	328	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	8.47e-132	1	328	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000433	0.999536	CS pos: 23-24. Pr: 0.9669

TMHMM  Annotations     

There is no transmembrane helices in KFA46002.1.