CAZyme Information: KFA45838.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA45838.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		93312.33	5.4521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651684:32749-35328(+)

Full Sequence      

MASPERIEALFGALTLQEKCALVAGKNMWETHNIDRLGIRSLKTTDGPAGVRGATWIDGT
HTTYIPCGISLAATFDPGLVEAVGGILGRETRSKNSHVLLAPTMNISRSPLGGRNFENFG
EDPYLSGCMATAYIRGVQRHGVGACMKHFVANDQETRRFNMDQQIDERTLREIYLRPFEM
ALAAEPWTAMTSYPKINGEHADCSEFLLQDILRREWGFDRLVMCDWGGCNDTVKSIAAGT
DLEMPGPPIRYGTALYEAFQEGRVPEAHVDASVKRLLKLLDQAGLLTDAAGSDLQQTEVG
QQKERSSDLPEFRELTRKAASEAIVLLKNTNQLLPLQPTRIKKLAILGPNAQKPTTGGTG
SAAVNPYYITNPYDSISQAIHQINPDIEISFSKGVYTNLQPPPPGDLLKTPDGSATGVRV
DFYAGHEFLGPVVGSSHWQNSVIFMMSDGDTPESLRGKPHGYRVTGVLTPTATGTYDFSL
SNTGKSKLFIDDNLLIDNAEWTQTGGSFMNCGSANRMTHLDLLVDRPYAFRVDNIVTPPP
IPAHDNTLFHTLSGLRVGLQLRTDEQALFDKAVSLAVEADTVILVVGHNNDTEKEGIDRT
SLRLPRRTDEFVEAICKANPNTVVVTQSASAITMPWLDTAPAIVHAWYQGQENGNALADV
LLGRVNPSGKLPITFPRRLEDHGSYKWFPGDAEKDYSEYGEGILVGYRWFDAKDIEPLWP
FGYGLSYTNFTISDIAASGTVNSSDVSSGVTISAKVTNEGSIPGAEVVQVYASPSPIIAN
KGRVSAPKSLVGVAKALIPAGDSKTIEVILDSRAFSWFDAEGKGGPASGGKWRCDKGMYT
CFVGTSSRQISGTVEVVVN

Enzyme Prediction     

No EC number prediction in KFA45838.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	4.3e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.81e-69	36	359	57	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.16e-69	61	850	116	757	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.82e-51	324	707	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	9.78e-41	4	823	50	756	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.26e-40	36	279	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28473.1|GH3	0.0	3	858	7	853
QMW31943.1|GH3	0.0	7	855	9	848
QRD91011.1|GH3	0.0	7	855	11	850
BAE61700.1|GH3	0.0	7	855	9	848
UDD60911.1|GH3	0.0	7	855	9	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.81e-158	7	855	6	833	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.47e-153	7	855	6	833	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.03e-128	7	850	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	5.10e-115	6	856	53	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	8.73e-104	14	856	12	661	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	1.12e-180	7	856	6	829	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.79e-180	7	856	6	829	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	9.05e-180	7	856	6	830	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	3.47e-179	7	856	6	829	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.05e-179	7	856	6	830	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KFA45838.1.