CAZyme Information: KFA45612.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA45612.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	KL651698|CGC1	85853.94	4.6554

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651698:13414-15882(-)

Full Sequence      

MKSVSFSTLLHSAAVFTVSLAISSDEKALIYGSDGPITLVSDGVTPAISILDFGQNFEGH
PVFEVVALSGDTSRFEVTFAESAASLGQYESDGPLPLAAAMETHRVKGFNITKTSLHEAR
LIQGAFRYQKLNLSTAGELILQNVGVRQTVHTTPLTELPSSFQCSDDDLTRIWHTGARTA
QLTEIPKNSIPDFWIVSNDGAFVESLASQPLAGAAATGLLEYQVSFKAKPTTGALMVSVL
MDTLSNGIDIVCDFTKGSVYALFERSVIASADLTLSPDLNSWVAIATTVQATGIQVAVNN
STILSFSQDKRFFGSFGLGAPLGHSVYYRDLVATDLTGDVIYSSALTERSFLDDFLMGSN
PADTIVDGSRRDRIAYNGDLDIALAASFASTYGSSFAQGSLTLMGSFQLTPGFFVPTAKI
QQGPLPDLIPANMTGLIGYSFNLITAFAQNYVATGDVAFAREWAPAITRMLDWADSRVVN
GLFTLDDPSFTGDWNYYDPPQTGASSKFNAVYAYALQQSLGFLKDSGIDTSIYEARLASL
RRAMHEQLFDTSLGAYVLTSEVRTGFSQDAQAIAILAGVPQANNASITALLSTMERELLL
PAGPLAFSNSTVSAGFAQKISPYASSYHLRAAFESGDSAGAMGLLKRLWAPMANPQNANY
TNCFWETLDPDGTPGLGLVTSLCHGWAAGPTAELIRFVLGIQPVSPGFKDWVVKPMTLGL
SFANGRQHTEKGDISVHWHFDGSGFVQMNVTGPEGGLVHLPTPLINSLDTSVIKVNGAIV
PPTDFPIAASGETIIVQEKKRSGC

Enzyme Prediction     

No EC number prediction in KFA45612.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	359	755	2.8e-64	0.7242063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	4.38e-12	357	690	24	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.54e-09	700	762	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL01042.1|GH78	0.0	13	800	15	804
QKD60287.1|GH78	0.0	24	800	24	801
QGI87784.1|GH78	0.0	24	799	24	801
QGI70426.1|GH78	0.0	24	799	24	801
QGJ01315.1|GH78	0.0	24	799	24	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.16e-09	622	737	557	675	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KFA45612.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996539	0.003525

TMHMM  Annotations     

There is no transmembrane helices in KFA45612.1.