CAZyme Information: KFA45608.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA45608.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	KL651698|CGC1	24388.61	6.4700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL651698:48950-49734(+)

Full Sequence      

MQLSKIAMGAVLVSITCAQQVKFMPLGDSITESACWRAKVWDQLSAAGLASSVDFVGSMT
NNVLNCRATSANFDTGHEGHSGWLSIDIANNYLQGWLVSYQPQIINVHLGTNDVFQGRTT
DAIVASYSRIVQLARASNPRIKIIFDKIIPAAFNNAAIAALNARIPAWAASLNSTDSPIW
IADCSSDAGFSQSFLRDGVHTNDQGDEFMARQIGPRLLRAVQDSLA

Enzyme Prediction     

No EC number prediction in KFA45608.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	21	211	2.7e-52	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.20e-36	21	210	1	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.88e-13	26	205	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	7.25e-10	26	215	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	1.76e-05	97	150	44	97	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239946	SGNH_hydrolase_like_7	5.25e-05	92	217	41	171	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79507.1|CE3	9.36e-80	19	226	86	292
CDP27869.1|CE3	9.36e-80	19	226	86	292
CAP61514.1|CE3	9.36e-80	19	226	86	292
AEO59370.1|CE3	3.76e-78	18	225	28	233
AEO64701.1|CE3	2.86e-75	19	226	29	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	2.49e-68	21	223	2	205	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	7.08e-68	21	223	2	205	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.88e-06	18	211	41	254	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999695	CS pos: 18-19. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in KFA45608.1.