CAZyme Information: KFA45482.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA45482.1
• CAZy Family: AA13|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		38982.04	5.1738

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL652466:3249-4397(+)

Full Sequence      

MHSFKPLCGQIMHYFNSRRRRFAASTSVALIFLTTIALFYNVVVDHLRDALHDGPDNSGP
DNSEAVPETEVRPEGRNLIPPKIWQILLPKKGNTDPVSPKQLQDTASWLALNTDYSYTLV
GERGSDDFVHNHYADNTRILDTFANMPNVGMKSDLLRYLLLQQYGGVYTDTDTIALKPID
DWVPVELRDQVRLVVGIEFDRRDGGAWADISHWVQFCQWTIAAAPGHPVFDIMIERVLQS
LQDLSEQHGTPIEELHPSFFEVMNSTGPAKAWTDAVFKQLQIYEPFLGDTKDLSFMTEPV
LHGDILLLNIDGFGMGQVHSHSTHDGTIPDLALMKHRFQGSWRGD

Enzyme Prediction     

No EC number prediction in KFA45482.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	105	184	5e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.66e-18	75	261	78	272	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.93e-10	107	184	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT06191.1|GT32	9.15e-140	3	345	9	352
UKZ83874.1|GT32	1.63e-135	4	345	10	352
QKX53490.1|GT32	7.80e-133	10	345	13	361
UKZ69802.1|GT32	2.05e-129	3	345	9	353
UKZ58174.1|GT32	3.49e-126	4	329	10	336

PDB Hits     

KFA45482.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.87e-41	79	345	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.09e-33	79	345	99	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.21e-26	79	306	96	352	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	9.22e-23	79	277	130	321	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000007

TMHMM  Annotations     

Start	End
21	43