CAZyme Information: KFA45359.1

Basic Information

• Species: Stachybotrys chartarum
• Lineage: Ascomycota; Sordariomycetes; ; Stachybotryaceae; Stachybotrys; Stachybotrys chartarum
• CAZyme ID: KFA45359.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	KL652497|CGC1	71577.38	6.1849

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SchartarumIBT40293	11453	1280524	0	11453

• Gene Location: location=KL652497:17481-19409(+)

Full Sequence      

MRRRQYLAFVALVAFGFCAYSLLRVSPAHGVDIDHSSPVKPAKEEDASQAAPHEPVTWEE
RPAVSGGPKPKPAQGTESHPISSLIKDAQKELDDTRRRQSNTLEDAVKEYHRRYGIPPPP
HFDKWFDFAKSNGVQLIDEFDTIHDLMTPFWGLKPKTIRGRAKEALGFDNALIGVAIRDH
KVTHMEKGEEWQQNATASMMEKFIQYLPDMDLAFNIHDEPRVVVPHEDLARLVHKAKTET
MPAASAVQKPANDFSKRAPELGDGHSFEETKLTRFNVFAHQPTWTNSRMSCPPDSPARIL
DDGEAADDVSKYAISELGFIYNTTAMADICLSPSLQWSYGFFDRPNAYNIVHDLFPIFSQ
SKISSYSDIIYPSPWYWYEKVTYEEDKDMPWTSKSDKLYWRGSTTGGFSRYGGWRRQHRQ
QFVQKINSGTQTKIMVNSGDEGNARWEVKEAPRGDYRDLVDVHFSHVGQCDDGDCNAQIE
FFNVKDRVEQQDAWASKYLLDIDGNAFSGRFYAFLQSRSLTFKLAIFREWHFEWLKPWAH
YVPLSLQGTEWLEAVRFFSDKNAGAEEAEKMAVASREWANKVVRKVDMEAWLFRLLLEYA
RVIDDNRETIGFDLLSRDQKLPQ

Enzyme Prediction     

No EC number prediction in KFA45359.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	603	2.7e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.15e-19	352	601	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.16e-09	356	601	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI14246.1|GT90	0.0	1	622	10	633
UQC78507.1|GT90	7.72e-307	1	612	1	608
QYT01287.1|GT90	3.82e-306	1	614	1	633
QLI64603.1|GT90	4.74e-304	1	621	1	650
UKZ59411.1|GT90	2.65e-303	1	614	1	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	6.86e-06	333	606	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	7.60e-53	17	620	92	673	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.67e-06	492	602	358	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	9.81e-06	348	603	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.833110	0.166887

TMHMM  Annotations     

Start	End
7	26