CAZyme Information: KEF63785.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF63785.1
• CAZy Family: GT66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		64726.14	5.1150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000001:5037363-5039174(+)

Full Sequence      

MVHPATAPKNAPTGFDFIVVGGGTAGCVVAGRLAENPNVSILVIEAGTNSTAEIPEINTP
ARAFELRGSQWDWKYKTTMIDRPDYTRVEKPNPRGKVLGGSSAENYYTWVRGSAATFDDW
AEYATDDWNWANTKDYFNKSATYHDDDNLYPAELAKIGNQGGPLHISHSDLLPETKPFRD
ALEAAWVSKGQELSTDVFNGTQKGLFKCVDTIYKGTRSNASVFVEGKDNITIMSSTHSKN
IVFEGPKAVGVTVIGPDGLDYTFYARHEVIVSQGVYESAKLLMLSGIGRKADLESFGIKV
LVDSEHVGQNLLDHPILSHVFKIKDGFGLDSHLLRAGPQKDGAVAAYRRNKGGVYSSGLL
ELVAFPRADEWLNKSKEYREYKAKNGGVDPFGPAGQPHFEVDFVPLFCDAFQWHFPTPPQ
GDYLTVIVDLMRPLSQNGEVKLKSTDPLDQPYINLNFFSEDLDLIAMREGVRMIDDILMN
GEGMKDIIESDYPWPMPRNSDEAMIKEILERSQTGFHPCGSCRFGKDIKQGVVNPKLQVY
GVENLRVIDASVFPVIPDCRIQNDVYMVAEKGADIIKAAYPALYA

Enzyme Prediction     

No EC number prediction in KEF63785.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	578	2.4e-149	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.50e-99	15	585	6	542	choline dehydrogenase; Validated
225186	BetA	2.97e-90	15	585	8	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.09e-42	433	571	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.87e-27	3	568	40	568	Protein HOTHEAD
366272	GMC_oxred_N	7.49e-23	93	316	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24176.1|AA3_2	0.0	1	584	1	584
AFR94515.1|AA3_2	0.0	1	584	1	584
KGB80031.1|AA3_2	0.0	1	584	1	584
UOH84707.1|AA3_2	8.28e-311	1	584	1	567
UPK96776.1|AA3_2	4.32e-294	10	585	6	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.30e-245	15	584	7	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.72e-245	15	584	7	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.06e-244	15	584	7	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	5.72e-62	15	578	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.03e-61	15	578	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	6.85e-63	15	579	7	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P64264|Y1310_MYCBO	9.91e-60	16	578	6	528	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	9.91e-60	16	578	6	528	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	9.91e-60	16	578	6	528	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|Q8UH55|BETA_AGRFC	1.10e-58	16	581	4	530	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999898	0.000137

TMHMM  Annotations     

There is no transmembrane helices in KEF63785.1.