CAZyme Information: KEF63206.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF63206.1
• CAZy Family: GT39
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072PTL8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		67060.73	5.6204

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000001:3288594-3290611(+)

Full Sequence      

MAATNGANRTSNALVSVDELTSQDYDFIVVGGGTAGLVVAARLTEDPNIAVAVLEAGQNR
MDDKNVSTPSLYPTMIGRPDYDWCMASIPQPNAGNKVYSMPRGKLLGGSSGINYLMYVRG
SKADYDANWESMDGCAGWGWSGMAPYFRKHHTIDRTDSSAKKPMFMPATESEEYHSKDGP
IHTSFNDWYMPLEEDFANAAYELTGGDRITTAYQGDHHGFYSSLGAVNRSDDYGKRSYAA
TGYLRPNLGRPNLKVLTEAQATKILLDGTVAKGVEFVHKGKKYSLNATREVILSTGVIQS
PQLLELSGIGDPDVLQAAGVDVIVENKGVGANFQDHVLGGVLYDLKPGVESMDALHEEEF
LKAQQAIYDKTGNGMFGNPGMAMGFISYAQIATPEELEATIKEIKTNSLAKSAFEKAQER
VIVDQLSNPGFSNLQTFCIPCRLDVAKGSDQTQFFGAPPKGKQQVSLLICLEHPLSRGTV
HIKNADPLAPPEIDPGYFRNEVDAKILAAGVKWIDQVARHPLVAKSLDTRELPPKNASLD
SEAERIEYVKNHISTQYHLIGTCALGQVVDNELKVKGVQNLRVVDASIFPGHVSGNIMAT
TYAVGEKGADLIKKDIKA

Enzyme Prediction     

No EC number prediction in KEF63206.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	615	3.5e-176	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.33e-115	21	613	2	532	choline dehydrogenase; Validated
225186	BetA	4.30e-101	24	618	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.74e-38	474	607	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.90e-32	100	336	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.06e-22	2	605	37	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ51478.1|AA3_2	7.80e-295	3	615	7	619
SMR55931.1|AA3_2	7.80e-295	3	615	7	619
SMY25122.1|AA3_2	7.80e-295	3	615	7	619
UJO21990.1|AA3_2	1.69e-292	8	615	6	613
SMR53556.1|AA3_2	1.59e-277	3	615	7	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.10e-67	24	615	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.88e-67	24	615	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	2.46e-66	20	618	1	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.49e-62	24	615	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5ZU3_A	1.89e-58	25	617	7	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.93e-155	13	615	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.93e-155	13	615	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.88e-143	16	615	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.91e-92	7	618	22	635	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	4.73e-80	19	612	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000034

TMHMM  Annotations     

There is no transmembrane helices in KEF63206.1.