CAZyme Information: KEF62006.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF62006.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		38486.67	6.2978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000002:4918777-4919862(-)

Full Sequence      

MIASQATNSGKGRNINYSSIPLLLHQTWKTRRADTWPEELCVAVEKWLNYVISDNMAYFF
WEDDGINRMVTQFEPGFMKHFTALPSNVERADVFRVLILKWFGGIVSNSGELSFQCGIGL
IFSQYADIDTEPLRQPASWISSSDLASWVDPITRSGYSFHDPVGVMLGIEADCKPSRDDY
WRMGYIYPIQLTQWALASKPGHDVLLRFMNTLSLRLDDVASRNGGNLGSSEAIKELRHIG
PVSLTGPVAVTNATKSLLSEQAGLRWNSLTGLTDGGQSKLVQDVLILPITAFSPGRGWYG
NMGSKPIDDESARVLHHAQGSWHSFDPQLELNKGCRTLLGLCRDW

Enzyme Prediction     

No EC number prediction in KEF62006.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.05e-16	20	205	82	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.22e-09	37	146	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57092.1|GT32	4.83e-130	2	345	88	412
QMW48355.1|GT32	3.15e-123	2	345	83	407
BAE66445.1|GT32	5.43e-122	2	345	27	351
BCR93027.1|GT32	6.79e-122	2	345	81	404
BCS05686.1|GT32	6.79e-122	2	345	81	404

PDB Hits     

KEF62006.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.10e-21	81	322	202	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	6.82e-19	21	322	100	375	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.96e-13	20	322	96	469	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.35e-12	16	293	126	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	3.19e-08	18	105	55	137	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KEF62006.1.