CAZyme Information: KEF61679.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF61679.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	AMGV01000002|CGC19	40652.03	9.2512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000002:3986170-3987228(-)

Full Sequence      

MRRSLLIFLLIAIIILTFLLHSVSTLISLLFEDASADAIHRSELPAPNTTLLEGRPQLIP
KILHQTYKNESIPERWQAAQQSCLDLHPDYEYMMWTDAKSADFIEKEYPWFLPTFVGYKH
PIQRADAIRYFVLSHYGGIYLDLDDGCKRRLDPLLSYNAWVRRTVPTGISNDAMAAIPQH
PFFLRVTKSLQGANRSWVLPYITIMASTGPLFLSVIWKKWISEHSNLEQEDWIGRVRVLM
PDEYNKHSWSFFETYKGDSWHGDDAKLIFWMGKNWLLLVVVGTIIGLTLIFLVWTVYSRV
LNLSSRKHGSAGSSPRVSAYRVPASSRVPLWMRWPGGLKKKQSYELVEQHDA

Enzyme Prediction     

No EC number prediction in KEF61679.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	156	9.4e-23	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.62e-75	57	293	80	313	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.70e-27	73	158	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57874.1|GT32	4.39e-150	1	351	1	355
AAP47108.1|GT32	4.39e-150	1	351	1	355
BCS17906.1|GT32	1.84e-149	1	329	1	324
CAK42232.1|GT32	1.67e-148	1	328	1	324
BCR89010.1|GT32	3.24e-148	1	317	1	312

PDB Hits     

KEF61679.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.94e-101	1	298	1	297	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	8.63e-99	26	297	26	288	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.22e-83	37	282	56	303	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.56e-80	48	306	46	297	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.86e-58	50	317	55	314	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.432800	0.567176	CS pos: 26-27. Pr: 0.2920

TMHMM  Annotations     

Start	End
5	27
275	297