CAZyme Information: KEF61503.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF61503.1
• CAZy Family: GT2
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072PQ82]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	AMGV01000002|CGC14	88815.89	8.9821

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000002:3480911-3483357(-)

Full Sequence      

MPPLRKTDRRSLPQKEESQPMTEIRMSANSTDTTLVSPDKELGFERAPSSHPVYGSYREL
QPPTPVRRPGMPDHHSRNLSDLMTESLQNSPMETPNGGSFPPFAPRATSSYSEAGTRSSS
PYPSPYPASTPFRSQETLRPLVPDSSPTYLHRDWVKEGSIAQLHHRDDKDLLAGKRRWLY
TYFAPLLGLLTLALYWLYFGMRITFVISAQQKFGAPFPLAWIFIAIEISVAVPIFLQTFW
SLFIMKKRRRPKLRLMGNDVPTVDVFITCCGEDFDVIMDTVRASCDLDYPADRFRVLLLD
DGKSDSLKDAIEDMRETFPNLFYKRRPKFPGVPHHFKAGNLNYGLDDVHNMPGGAGEYMA
ALDADMIPEQHWLRAVLPHLLVDDKMALACPPQLFYNVPKDDPLCQSLDFFVSVSETVKD
AMGVAWCTGSGYVVRRTALDQIGNFPCGSLAEDVATSTLLLGKGWKTAYVHEKLQFGTVP
EDYGSHLKQRTRWAIGTVDTAFKLKFCLWGQAVKHMKLAARVSSFIYAFLSLFNVFLTLS
IFAMPIVLISNKPLVAYANENQLRWLIRACFATMACNRLCEFVLYIPSGYATGQRGSRSQ
LWMSPYVALCIIRSFLLPTWLGGQTQAFKPTGSLQSALNERFPKLRKPMYRRIWTICVNY
MAGFHVLYVYFVLVAVCLSSYRSIITQYTVRAKLVGLLTHAFWPPLSWVIVCSSFWIPFT
YAVDPPSMPDREELLVRDPKTGVAHPTEKAKKIGVSRQSWLFEMEYSFTTLFTAVVFVAA
FFY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	361	545	1.1e-17	0.9390862944162437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	6.94e-97	261	501	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	4.28e-40	205	574	2	355	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.81e-28	220	531	230	520	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	5.52e-22	265	453	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	1.67e-19	275	496	14	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK89109.1|GT2	1.23e-315	133	781	200	848
CEI40044.1|GT2	9.68e-312	133	781	192	845
CZS73870.1|GT2	8.11e-310	127	781	163	822
QPC73057.1|GT2	1.04e-309	133	781	196	849
UKZ45919.1|GT2	2.20e-309	134	781	8	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.55e-23	261	531	273	533	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.68e-23	255	499	122	377	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.20e-23	255	499	134	389	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.21e-23	255	499	135	390	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CW87|ACSA1_KOMXY	3.91e-26	227	562	116	446	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.42e-25	258	613	146	481	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P58931|BCSA_PSEFS	1.81e-25	235	513	137	408	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|P19449|BCSA1_KOMXY	7.57e-25	258	499	146	379	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.71e-24	227	514	116	393	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

Start	End
178	200
222	244
525	547
652	674
695	717
760	782