CAZyme Information: KEF61355.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF61355.1
• CAZy Family: GT2
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		95571.00	6.1141

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000002:3048822-3051455(-)

Full Sequence      

MALPGRILDPFVNMNELAARWVADKSWTYSTTFNSPPITSGKGDRVDLVFKGLDTYATVK
LNGSKILEADNMFLEYRVEITEQLEQKDNELEITFASALLRGRELVAEHAQEHKFIAHQT
ELGRMPVRKAQCHWGWDWGPILCTSGPWKPIFLEAYTTRVEDVWFQAAVSEDLKAVSGKL
LARVDVGRNRNGAEVAVKFTLSLEKKTVFESQEAVDSEGLSTANFKLEDPALWYPHGYGK
QSRYELKATLLFNKVKENSLTKLTGFRKVQLVQEKDEFGKSFYFRINNIDVFCGGSCWIP
ADSFIPRIGREGYRKWMELMVDGNQIMTRIWGGGIYEEEDFYDACDDLGILVWQDFAFAC
ASYPTYPSFLKQIEVEARHNLRRLRTRPSLVIWAGNNEDYQIQERYNLDYDYEGDKNPES
WLKGSFPARYIYEYQLPKLVEEEDPGAIYHPSSPWGDGKKTFDPTVGDIHQWNVWHGLMR
RHQELPTMGGRFVSEFGMEAYPHLSTIKSAITDPKQQHPGSMVMDYHNRAINHERRLLTY
VAENFRLNYDLPVFTHLTQITQSDVMESAYRSWRRDWGKPGARKTGGILVWQLNDCWPTM
SWAVADYYLVRKPSFYAMKRNLKPVAIGLSRPFYDWTAGHIDPTVATRDRKYDVWVASSR
TEAVRADITIRFLSIKTGKEIAATIKKSVQTLPNSTTDIIQQGDVDVDSKFDHTKPFNHE
LYDPYVISGSISVDGEIVSTGTAWPHPFKYLDFADRGVKVQASQSRLTITADKPVHGFVF
EEKKDWLNFSDNGFDIMPGEERVVDVTGTKWEDDELRWTYIGAESGSIGLKTV

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	680	4e-85	0.6303191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.20e-66	4	631	44	638	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.23e-11	651	750	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	2.92e-08	158	267	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	9.32e-06	758	815	8	65	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI66193.1|GH2	0.0	6	831	43	877
UKZ88363.1|GH2	0.0	6	830	43	887
QYS99024.1|GH2	0.0	6	830	43	885
UQC76680.1|GH2	0.0	6	830	45	883
UKZ51991.1|GH2	0.0	6	830	43	885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	8.53e-128	5	629	60	660	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.12e-104	9	815	46	825	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.21e-104	9	815	48	827	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.26e-104	9	815	48	827	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	5.86e-104	9	815	46	825	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W2|MANBB_EMENI	6.35e-292	5	822	44	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q4WAH4|MANBB_ASPFU	9.47e-287	6	822	45	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	1.84e-286	6	822	45	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	1.90e-286	6	822	45	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	5.22e-286	6	822	45	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000003

TMHMM  Annotations     

There is no transmembrane helices in KEF61355.1.