CAZyme Information: KEF61072.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF61072.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	AMGV01000002|CGC12	43364.62	6.9136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000002:2259518-2260663(+)

Full Sequence      

MYVRKSVYPGWQVRRFLPVCAICILLIILLSTAGSFGEFSAEISYKSTANSGRFPRKIWQ
TWKVDPLGFEERDLSVARTWTSKNPEYRYEVLTDQNDVSYVEIHFGPSGFNRLDIIYMYK
SLRLKIIKADLLRYLVMYVEGGVYTDIDVEALKPIHRFIPQRYSEKDIDMVIGVEIDQPD
FNNHTILGKKSQSFCQWTFMCKPRLPVMMVLINNILKWLNQVAMDQKVPISDIQLGFDEV
ISGTGPSAFTKALLSHMSAREESTVQWDCFHNLAESKLVGGVLVLTVEAFAAGQGHSDSG
NHNAKTALVKHHYHASGWPTAHPRYNHPIYGEVEKCNWDAECVKTWDANKATFEALPQEE
QLRQIAMKENGDQTSFPAPGS

Enzyme Prediction     

No EC number prediction in KEF61072.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	161	1.4e-18	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.32e-23	54	310	82	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.86e-13	78	165	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62098.1|GT32	2.01e-187	12	369	13	370
QIW98346.1|GT32	5.96e-183	12	365	23	371
QMW40889.1|GT32	1.60e-180	12	377	9	374
BAE58544.1|GT32	1.60e-180	12	377	9	374
UDD56882.1|GT32	1.60e-180	12	377	9	374

PDB Hits     

KEF61072.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.74e-36	55	318	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.63e-28	42	316	86	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.94e-27	53	290	129	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.79e-22	38	316	83	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999940	0.000072

TMHMM  Annotations     

Start	End
13	35