CAZyme Information: KEF59803.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF59803.1
• CAZy Family: GH63
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	AMGV01000003|CGC8	90758.87	5.3982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000003:2980451-2983062(-)

Full Sequence      

MGSMPVQSPFDVEDVLSQLDISEKVALLSGIDFWHTAPVHRLGIPSIRLSDGPNGVRGTR
FFNGVPAACLPCGTGLAATWDTALVKRGGTLQGDEAIAKGASVILGPTTNMQRSPLGGRG
FESFSEDPYLAGAMSAATINGIQSTGVAATIKHYVCNDQEDQRQSVDSILTERALREIYL
MPFMIAEKDSRPDCYMTAYNKVNGVHASENPRLINDILRKEWGFDGLVMSDWFGTYSTTE
AIKAGLDLEMPGPSYIRAKLVNQALGCGKLSLHEVDTRVREVLKLVKKVQPLGIPENAEE
TTIDSPETAAALRALSSNGLVLLKNEGNVLPFKRDKTTAVIGPNAAYASFCGGGSASLQP
YYAVSPLEGVRSKVPGAQYELGAPAWKSVPLMSRVTKTKDNQIGLTMKVFIEPPSVTSRK
AVDEVFVNKSDILLVDYKHPLVKTYLYWLELNGTFTPDETAEYEFSLACAGSGKIYVNGE
VVVDNETNQRPGNTFFGSGTAEEIGTLKLEKGVTYNILTKFGTFPTMSFTTPGTTGFGSG
GLRIGLERKAELQSEIERAVKLAKEVDQVVLCAGLNAEWETEGHDREHMDLPPGTDELIQ
AVVAANPNTAIVLQSGTPVTLPWVHHVRSIVQAWYGGNETGNAIADVIFGDTNPSGKLPL
SFPVKNEDNPAFLNYKSERNRAIYGEDVYIGYRFYEKTNKEVAFPFGHGLSYTTFELSAL
TVDDNGVDIVMSVSVSNTGNVDGAQVVQAYVSQQKPSINRPKKELKGFSKVFVKAGETAK
AQIVMSKKYAASFWDEGRDAWVMEKGAFDVLVGDSSATTPLKGQFHVIQSSWWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	38	251	1.9e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	8.58e-86	41	819	101	757	beta-glucosidase BglX.
224389	BglX	5.84e-72	41	374	57	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.92e-55	320	712	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.60e-47	15	814	56	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.08e-41	41	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24157.1|GH3	0.0	10	836	6	834
SMR61167.1|GH3	0.0	10	836	8	836
SMR64317.1|GH3	0.0	10	836	8	836
SMQ55981.1|GH3	0.0	10	836	8	836
SMY29662.1|GH3	0.0	10	836	8	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.17e-276	8	836	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.73e-271	8	836	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.65e-148	11	827	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.24e-121	16	816	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.12e-105	6	827	48	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	11	836	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	11	836	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	11	836	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	11	836	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	11	836	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999679	0.000333

TMHMM  Annotations     

There is no transmembrane helices in KEF59803.1.