CAZyme Information: KEF59270.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF59270.1
• CAZy Family: GH5
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A072PUU1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		90675.30	5.8546

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000003:1464996-1467754(+)

Full Sequence      

MPLLYSNVNIDLFLQEASLLEKISLLAGADLWHTTPIPRFGVPAIKTTDGPNGARGCKYF
NPVPAACIPSGGALGATWNDELIQQAGELLSKECAAKGAHVWLGPNVNIPRSPLNGRAFE
CFSEDPHLSGMLAAAIIRGVQSGGTLAALKHFVANDQETEKISIDVSVSDRALREIYLMP
FQIALRDSNPGVVMSSYNKVQGTHASESPKLLDQILRKEWGFGGLVMSDWYGTYSCEAAL
IAGLDIEMPGPPRHRTRGIVQAIATGKLNAYVIDVRVRKILEFINQAASTPVAEVEAIRD
VPNDRVFNRLLATESIVLLKNSAGTLPINPQECNEVAIIGPNAKLPGACGGGSADLRPYY
TTSIFQGIKGSLPPTTTIRYEPGVYGHILLPIFSEANVTNDIGQPGVSIAMFNEPSTCQG
RTSFDTCTIPDTTYQLMDYSHPEACDPFYISMHASFIPEQDGVYEFGLASYGISDLYIDD
VLVINNSADQVFGGMFFGKGSVEKRGVFEMVAGKQYTLRVEAGGASTNRLTGGHGLPIPG
GACRLGGCVKIDPKESIQEAVKLARRCKTTFVVAGLNSDIEKEGRDRPTMDLPPFVDDLI
DSVLAANPAAVVITQSGSPVAMPWRKSASSILHSWYGGSEAGNAVADVLFGRANPSGKLP
VTFPAKLEDTPSYLSFGTDNGKILYAEDVFVGYRGYEARNTEVAFPFGHGLGYTIFAASS
LTLTPLAKPTQISIDIKNTGGRAGAEVVRLYISFCATSTSKSRFLRPKRELKGYKKVSLQ
PSETKVVVMPISKYSTAVWDERRNSWCCERGLYRVSVVVGEEALQETFEIQNDEFWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	249	4.2e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.36e-71	69	831	121	765	beta-glucosidase BglX.
224389	BglX	9.93e-71	37	378	55	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.07e-48	544	693	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.17e-44	69	282	89	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.35e-33	18	797	61	751	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92689.1|GH3	0.0	8	838	9	838
UQC86128.1|GH3	0.0	8	839	437	1237
CEI63709.1|GH3	0.0	6	838	7	836
QKD61585.1|GH3	0.0	8	838	9	837
ABF50857.1|GH3	1.75e-276	7	839	10	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.02e-206	6	839	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.01e-200	6	839	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.08e-125	8	817	3	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.12e-110	5	817	6	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.64e-93	16	806	60	802	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	3.10e-277	7	839	10	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q5B6C7|BGLH_EMENI	1.88e-258	9	839	6	831	Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglH PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	6.66e-257	10	839	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	1.89e-256	10	839	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	2.58e-256	10	839	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000021

TMHMM  Annotations     

There is no transmembrane helices in KEF59270.1.