CAZyme Information: KEF58761.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF58761.1
• CAZy Family: GH43
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072PG19]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		40970.57	4.2485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000003:7724-8824(-)

Full Sequence      

MSPFFLVVSTLLYIQSYASQICERRTRLLARASSSECDLYVVSGQDNLFENYAFSDFRNL
SNYSINWPSSITAEEDQGGENITSAYFAHPPFSDHWEIRRGIRNAESDVPMIYSAQNVYI
SQDPSSDGSQTYLTLRTTRLQDFQSVVQLVSRPDNLLHASMRTRMKIISDGKDGDNVAGG
AVVGFFTYESDTQESDIEVLTKHPSDIVELSTQPASSTTPGADASVTIPNGKDWTEWVEY
RMDWFAGRNIWYLDEEMMLNSTDSVPTEPSQLMLNLWSNGQSFSGRMRPGREVYVAVQWI
EIAYNVSNQGQSLNQTDGLTQCLVDSVETKGIPEVIQNSSVTQSAVSTALKMFGTIVLVL
IAWYCT

Enzyme Prediction     

No EC number prediction in KEF58761.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	302	1.2e-61	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	8.46e-39	91	302	8	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	8.22e-06	180	300	82	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63760.1|CBM1|GH16_22	3.55e-50	33	340	31	346
EAA63092.1|GH16_22	3.23e-49	37	316	51	345
CAE7012560.1|GH16_22	3.48e-49	33	340	39	358
BCS21543.1|GH16_22	7.46e-49	54	308	37	290
UKZ63659.1|GH16_22	3.31e-48	18	363	29	405

PDB Hits     

KEF58761.1 has no PDB hit.

Swiss-Prot Hits     

KEF58761.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.129480	0.870505	CS pos: 18-19. Pr: 0.8179

TMHMM  Annotations     

There is no transmembrane helices in KEF58761.1.