CAZyme Information: KEF58369.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF58369.1
• CAZy Family: GH35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	AMGV01000004|CGC24	75496.88	8.1980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000004:3281834-3283999(+)

Full Sequence      

MEDSSSSSLRLRINGGSVTANANPTSVTKTEAKFDIVKVESPKPEAPPARSKWSKYLPIV
SFCNLVFYLSALFLNIFAAWAQGQDPSVLIVPLIFAVSQVFEHCSQFTEAIWHAIVFLNK
EDFVRPALRLRGSVVPPVVMVIVTCGEPLEIIMDTIRAAVHVDYPPDKLRIIVADDGDSA
SLRTQVTNLQASHSVLHYTSRLGGKGYKAGNLNTCLRSFVPTLGFEFDWICVLDADMIPA
FGILRSLLPHALEKADVGMVTTGQHFYNIPDNDPLYQSNITGNHAEDGARDSCGSAWCPG
SGFVMRAQAWLDIGGFPEYAVTEDLFTSWHLHGKAWKTMLIHEVLQWGLQPDCFVVHMKQ
RRRWWTGHLSRVLTTGMSLFDDKLKQANFVQRAAMFQHCLRPFNNTVFKAISLILITLCV
ATGGTVLATPGKGCVLSIFISLSIRGLIARHSEFKDLPDLDRVWNMRRRHATNTWLGLHF
AIDTGKAVMSTLFPGRLDIQPLGFEVSGVTERTENSAHERNPRRRLRCWDRVLLLNAKEG
ILYHVLVACIITALILRQLVRLALSSDSFWYDVCFSVGFPGLGLIELLPLEFTPLLYAAF
PPTMPERRDLMQYDNKLMIYLPKETSKQMRWIASTSVWLAVPHLVGFCWLCIVMVSMPWR
YVPTIEMLERK

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	136	365	3.9e-22	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.11e-68	144	369	9	231	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	5.78e-24	146	444	64	352	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.50e-19	150	324	10	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
236918	bcsA	2.70e-17	144	367	268	487	cellulose synthase catalytic subunit; Provisional
404520	Glyco_tranf_2_3	5.23e-14	142	364	7	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA12172.1|GT2	5.87e-77	47	636	174	763
ATZ49458.1|GT2	1.46e-76	82	635	207	759
CCD45106.1|GT2	1.46e-76	82	635	207	759
ANH56591.1|GT2	1.26e-75	53	655	170	772
CBY01550.1|GT2	1.44e-71	47	634	160	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.34e-22	85	373	83	380	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.51e-22	85	373	95	392	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.51e-22	85	373	96	393	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	8.39e-18	84	367	225	500	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WX61|BCSA3_KOMXY	6.67e-21	77	367	100	376	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P19449|BCSA1_KOMXY	1.56e-20	77	367	100	376	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|P0CW87|ACSA1_KOMXY	4.30e-20	77	369	100	378	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|Q8Z291|BCSA_SALTI	7.26e-20	84	387	225	519	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q9SJA2|CSLC8_ARATH	7.49e-20	118	403	209	501	Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=CSLC8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000062

TMHMM  Annotations     

Start	End
59	81
406	428
540	562
577	599
637	659