CAZyme Information: KEF58112.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF58112.1
• CAZy Family: GH31
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	AMGV01000004|CGC25	41987.05	4.2090

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000004:2607435-2608670(+)

Full Sequence      

MKTAILAALAAAPSVLAAVHGFNYASQGQSYETFAAQFKIAASLEGASDFTSARLYTMIQ
EGTQNTPISAIQAAIETKTTLLLGLWASVDQTAFSNELAALKSAIDQYGSDFADLVTGIS
VGSEDLYRISTIGIAADSGVGQSPDVLVDYIGQVRKAVQGTSLGSKPIGHVDTWNVYVNQ
SNAELVSACDWLGLDEYPYFQTTDTNNIENAGSLFFEAYDKVSAVAGGRPIWITEAGWPT
SGPTSHLAIASTDNAESFWQDVSCELQRRNIDFWWYILADGGASPSFGVSENGKPLYDLS
CKASAKSNSTSSTSSSSNSTATGSYGSSGSQGATSSRSGSAEPTGSSPTSGNGAPTTQGA
GSTLATSTQAGNGASSIGSGAPAASFTAAASRMSGSVLGVAAGALLAVFAL

Enzyme Prediction     

No EC number prediction in KEF58112.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	21	301	1.7e-16	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.28e-29	40	292	65	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.62e-07	121	301	108	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX00265.1|GH17	5.07e-105	1	309	1	317
QRC96667.1|GH17	5.19e-104	2	306	4	321
CAE7194820.1|GH17	1.29e-103	1	301	3	316
CAP82907.1|GH17	6.59e-103	1	304	1	312
QKX54194.1|GH17	3.95e-102	4	301	6	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.20e-22	81	295	94	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	8.87e-102	2	308	4	318	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|B0XXF8|EGLC_ASPFC	2.26e-101	1	307	1	316	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	7.98e-101	1	305	1	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	5.07e-100	1	307	1	316	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.63e-95	17	310	18	317	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999702	CS pos: 17-18. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in KEF58112.1.