CAZyme Information: KEF57903.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF57903.1
• CAZy Family: GH3
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072PF69]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		71375.71	6.9679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000004:1987703-1989587(-)

Full Sequence      

MSLRNPNKSHVQGMVRSRKLLVLTFLIATAIFTVLWLRDPYSIEESTQNILHGHHAHEEN
RPVLPASSLSHPIHKLVAKADGDFTAVLARQSRSLADAVAEYRRRYKLPPPPNFDKWYNF
AKKRGVELIDEYDTIYHQLLPFWALEPSVIRERTREAIGFDNALIAVMIRNGEVTRIEGG
GDMYQWHREATPIMLKDFLRYLPDMDLPFNIHDEPRVVMQHDDLLHHVQVATDQNMPKAY
ESKDLKNHWSPRPEDLGEGIRIKEYRTTRFNRFAHQPTWSNSRLSCSPDSPARSCLNDSC
PDNVTAYSDLPLGFIRNTTAFSDICNSPSMEKSFGFFDRPNAFDVTHDLFPIFSQSKISS
FQDILYPSPWYYMGRVKYEKEKDMPWEQKDPTMFWRGSTTGGFSRDGGWRRQHRQRFLTK
IQPLSNSKILELDNSTTTPDMWREKEIRTESMAHYFDVKFTHIGQCDPGDCDAQRAYFGT
VEPVNMFDAFNARYLLDIDGNAFSGRYYAWLLSKSIVYKLAVFREWHDEWLRPWVHYVPL
GLVGDEYVESVRYFDQVESGKIEAKKIADQSRQWAQKALRNEDLEVWYFRLLLEYGRLID
DNRYNIGFSL

Enzyme Prediction     

No EC number prediction in KEF57903.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	328	599	4e-79	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	9.49e-23	347	598	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.59e-14	351	598	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	1.19e-252	65	608	50	588
UCK57446.1|GT90	5.48e-251	71	610	85	619
BAE54850.1|GT90	2.20e-250	71	610	75	609
BCR83603.1|GT90	2.03e-241	70	610	65	600
APA08219.1|GT90	2.81e-241	16	609	49	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.08e-08	328	602	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	3.43e-07	351	599	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.89e-43	64	605	146	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	4.76e-09	351	599	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	4.78e-09	328	599	138	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.36e-07	328	602	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.81e-07	328	602	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000005

TMHMM  Annotations     

Start	End
20	37