CAZyme Information: KEF57739.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF57739.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		54792.22	6.8647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000004:1507645-1509114(-)

Full Sequence      

MSLRDDLMKSRRPRGNRFGRQTRKILLLLVGCVAAFLFLRKVVESSSPASFLQIAPLSRY
PVGGTFPKKIWQSWKVDPTRFEDRDAERARTWTVKNPAYRYEVLTDDNAMSWVEEHYGPT
GLNRPDIVSTFMALENIRIIQSDLLRYLIMYAVGGVYADIDVEALRSIDHFIPKRVDQLE
IDMLIGVETDEPRLKDHPILGSKSQSFCQWTFMCKARVPVMMKLIDHILDWINDLARKQN
KPISEVKLDFDEVLSGTGPSAFTNAILEYMSELTRTKITWDNFHNLEESTVVGRVLVLPA
EAMAAGTGHSDSGNHGGRAALVKHHFHASSWTDAHPRYKHPIYGEVENCNWNVDCVTLWD
TNTAFFSSLPEEVQLKMIEIKKLDDAQRPKDPAVQAAKAVPAPNIGPPAGQPPTEPIALQ
DLAPGDKDQLAAELSETDSRTFEKLGQGKAGHEKPAQGKSSHGKADQENSNQDKPAQGKQ
DQGKNGLRS

Enzyme Prediction     

No EC number prediction in KEF57739.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	89	173	2e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.24e-18	60	293	76	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.26e-11	83	173	2	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO17754.1|GT32	1.35e-157	67	384	60	377
QMW40889.1|GT32	5.37e-148	23	387	8	371
QMW28814.1|GT32	5.37e-148	23	387	8	371
BAE58544.1|GT32	5.37e-148	23	387	8	371
UDD56882.1|GT32	5.37e-148	23	387	8	371

PDB Hits     

KEF57739.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.04e-35	61	333	137	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.22e-31	60	333	93	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.62e-28	66	299	130	357	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	8.45e-20	60	333	90	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000007

TMHMM  Annotations     

Start	End
25	43