CAZyme Information: KEF56992.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF56992.1
• CAZy Family: GT76
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072PB40]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		44891.60	8.7262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000005:1446402-1447777(+)

Full Sequence      

MLQDPKCSMACPPQLFYNVPPDDPLCQSLDTFVHISEPIKDSMGVAWCTGSGYVLRRAAL
QSIGGFPIGSLAEDVCCFSMLLGSGWNTAFVHEPLQFGTVLDSLTSHLKQRTRWTIGTVQ
TSFKLRFSIFGPLVKHMTFSQRLCGFVYTVSSLFTVFLVLSMFTAPIVLISGGNLVPYTS
MNQLKWLIRSNFLTIILNRINEFISYLPSGYRTGQRGARAMMWMAPFHALSVIRTFLLPE
WLGGKVAVFTSSGSQKADLNERDPKPRAPVWRRLVVTMWDCQCYLHLVYIMFVVAAVITR
KTTLKKTLISLLTHAGWPPLIWLTCILSCWVPINYALFPPDCPDRQDLLDRDPDTGVAYP
KEDSKHTKSTWAAWAFEAQNSFITLYMTVVFVLSFWF

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.67e-40	1	121	109	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	3.74e-15	48	212	214	381	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.94e-11	50	144	420	510	cellulose synthase catalytic subunit; Provisional
404513	Glyco_trans_2_3	3.44e-11	2	168	23	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133057	CESA_NdvC_like	6.47e-06	31	120	141	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ49458.1|GT2	1.62e-164	1	395	377	781
CCD45106.1|GT2	1.62e-164	1	395	377	781
CBY01550.1|GT2	6.69e-163	4	397	369	770
QSZ31828.1|GT2	3.11e-162	1	395	390	795
APA12172.1|GT2	2.63e-161	1	395	380	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.98e-09	40	144	423	523	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	9.61e-07	2	144	252	397	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.91e-07	2	144	264	409	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.91e-07	2	144	265	410	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CW87|ACSA1_KOMXY	2.68e-13	1	202	253	458	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|O82859|BCSA2_KOMSB	3.72e-12	1	176	255	433	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	4.94e-12	1	195	253	450	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|P58931|BCSA_PSEFS	1.12e-10	2	144	264	409	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|P58932|BCSA_XANAC	6.09e-10	2	144	258	403	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

Start	End
146	168
276	298
311	333
374	396