CAZyme Information: KEF56666.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF56666.1
• CAZy Family: GH16
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	AMGV01000005|CGC12	48046.91	6.5597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000005:537221-538516(+)

Full Sequence      

MGSTSRKKYALVGTGGRSSFFYSSIASDFQNTSELVAFCDVNQTRMDYANAKIQALGHPA
VPTYQAHDFDRMVEETRPNEVIVTSIDRTHNIYIVRAMELGCDVVSEKPMTIDVPRCREI
LDAVERTGRKLRVTFNYRYAAHNTKVFELISSGAIGTVNAIHFEWMLNTSHGADYYRRWH
RDKRNAGGLLVHKSTHHFDLVNFWLGSRPETVVAMGDLKFYGRENAEKRGVTKFYTRAHA
SENAKDDPFALHMENNAQLKAMYLDAEKEDSYYRDQSVFGDGISIEDTMGVLVKYRSGAI
LTYSLTSYSPVEGFRVAFTGTKGRLELEVVERSYINSGGDQSQEGALETRSIVLRPMFGK
PREVDIPASEGGHGGGDPRLLNDIFGTPGEDPYHRAASHVDGALSILTGIAANLSINTGQ
TVRVDDLMDIP

Enzyme Prediction     

No EC number prediction in KEF56666.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	8	185	4.4e-24	0.46365914786967416

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	3.11e-38	8	219	5	208	Predicted dehydrogenase [General function prediction only].
397161	GFO_IDH_MocA_C	1.03e-17	148	424	2	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
396129	GFO_IDH_MocA	4.96e-17	7	135	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	1.22e-04	81	188	69	168	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	1.32e-32	8	431	396	758
UPK44969.1|GH0	5.51e-16	8	285	5	268
SDF34494.1|GH109	7.49e-13	5	381	51	388
VTU39411.1|GH0	1.81e-12	4	233	16	231
QUE53250.1|GH109	4.39e-11	8	192	57	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A02_A	6.36e-13	57	215	53	208	Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
1ZH8_A	1.22e-09	30	206	39	212	Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8],1ZH8_B Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8]
3MOI_A	6.21e-09	33	215	28	200	The crystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
3E18_A	1.31e-07	5	214	2	198	CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3OA2_A	2.60e-06	81	213	77	207	Crystal structure of the WlbA (WbpB) dehydrogenase from Pseudomonas aeruginosa in complex with NAD at 1.5 angstrom resolution [Pseudomonas aeruginosa],3OA2_B Crystal structure of the WlbA (WbpB) dehydrogenase from Pseudomonas aeruginosa in complex with NAD at 1.5 angstrom resolution [Pseudomonas aeruginosa],3OA2_C Crystal structure of the WlbA (WbpB) dehydrogenase from Pseudomonas aeruginosa in complex with NAD at 1.5 angstrom resolution [Pseudomonas aeruginosa],3OA2_D Crystal structure of the WlbA (WbpB) dehydrogenase from Pseudomonas aeruginosa in complex with NAD at 1.5 angstrom resolution [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	5.97e-76	7	430	2	425	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|Q54728|Y1686_STRPN	2.24e-11	8	216	3	196	Uncharacterized oxidoreductase SP_1686 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1686 PE=3 SV=2
sp|O68965|MI2D_RHIME	3.28e-10	81	214	67	192	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
sp|P49305|YMO1_RHIML	4.60e-08	69	218	58	203	Uncharacterized oxidoreductase ORF334 OS=Rhizobium meliloti OX=382 PE=3 SV=1
sp|B2UL75|G1091_AKKM8	6.98e-08	8	192	76	267	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KEF56666.1.