CAZyme Information: KEF56019.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF56019.1
• CAZy Family: GH132
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	AMGV01000006|CGC1	42067.44	5.1062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000006:554927-556240(-)

Full Sequence      

MISCQNYTRAFLTLTLTLTLPLLIHPTASTTLPRHHNPPVKNSVWSLSNFKSLITFGDSY
TDESRLGWFINHNGTAPAAGTLLPESFSTPGGGRTWDRYVIQYTGETSSSGQWMPALTLY
DYAVSGAVCSNEITPRWFEAINAPFPSVLEYEVPAFLADLPATQVNSTPPTPLFPLGSLS
ATSAVYALWIGTNDLGIWAFLTNSQIPGKVLADYTACIYAVFDALYSAGGRVFVLMNTVP
LHLAPLYANDTLHGVGDNQYWPEKWPNHTAIAETMHEAITSVNEVFRVQTPFELLVAGRY
PGASFALFDTYKLIGDIYNDPEMYLNGTGVEKGGESVWGYENHCSVNGSSCVKLQNGTNP
DGYLWYDELHPRHAPLRRIFGC

Enzyme Prediction     

No EC number prediction in KEF56019.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	53	373	1.2e-55	0.9550561797752809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.16e-35	52	371	1	255	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	2.32e-12	46	371	25	317	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238875	SGNH_plant_lipase_like	2.18e-07	183	371	129	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	1.42e-05	50	371	1	265	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	4.57e-05	184	330	80	210	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	2.17e-101	42	371	33	331
QMW44554.1|CE16	1.36e-98	19	371	3	327
QRD84022.1|CE16	1.36e-98	19	371	3	327
BAE62044.1|CE16	1.36e-98	19	371	3	327
QMW32524.1|CE16	1.36e-98	19	371	3	327

PDB Hits     

KEF56019.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	1.50e-79	49	371	26	319	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007724	0.992259	CS pos: 29-30. Pr: 0.9293

TMHMM  Annotations     

There is no transmembrane helices in KEF56019.1.