CAZyme Information: KEF55307.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF55307.1
• CAZy Family: GH13
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A072P6I5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	AMGV01000008|CGC5	44655.29	4.6808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000008:1173943-1175396(+)

Full Sequence      

MSSKMPLWAQIKSIWKEKCVGCFAQSEELVDRIPLPPSAANHVTYREIFCSSFGTHSNKL
SPRIYLFLLTSTLVIVVNSHPSHLSQDSPSSALAELHSGLTVEETNPAAQSQDQQYGQPQ
SVALDAGSQTGTQAIGEPTASASKQTSDADQIEDAWVVQGVGTFSNKAVYTFNGDTLPEG
LFKSDYPVQDSERDMDEGVPQIPYNHRFEPENVQIRNGSLYLRVPGRQKPRKRQNKEISS
AQIETTETHILHASVRTRARFSIFFYSNDQHETDIEYLTDPRSLSNNGPDDPIPIWYSNQ
KRDPVGSSPSAETGPAPFDATSRVHEYRIHWTAEFTAFYIDGVLQKYLTENVPSLPGPWL
WNNWANGDKGWSVGPPAEDNELEIQSIVMYYNTWAPDEE

Enzyme Prediction     

No EC number prediction in KEF55307.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	215	390	2.4e-29	0.9427083333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.04e-32	200	390	19	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.31e-04	203	356	24	172	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	0.001	208	366	1	157	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62486.1|GH16	1.95e-61	134	393	17	262
CZS81947.1|GH16	2.01e-61	138	393	21	263
QPC71194.1|GH16	2.01e-61	138	393	21	263
QPC59862.1|GH16	2.01e-61	138	393	21	263
CEF78656.1|GH16	2.01e-61	138	393	21	263

PDB Hits     

KEF55307.1 has no PDB hit.

Swiss-Prot Hits     

KEF55307.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000054

TMHMM  Annotations     

There is no transmembrane helices in KEF55307.1.