CAZyme Information: KEF55219.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF55219.1
• CAZy Family: GH128
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756		82427.98	4.6253

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000008:865947-868304(+)

Full Sequence      

MDDSDAINRAIQAPGNRCGGGNVTFGRFCESSTVTPALVYFPPGTYLVSKPLIMYYASQI
VGDAVTPPTIKVQANYTNGQIGLAVFDSLPYIPSGSGNQWHANQNNFFRQLRNFIIDMTG
APLTCAGIHWQVAQATSMQNIVINMVPKDVVNNQQQGIYMENGSGSFFSDMVITGGAIGA
YLGNQQFTTRSIRFDGCSTAIKMNFDWLWLFTQITIVNCDVGIDMSNGGTANQAVGSLVL
IDSNIAATQGIITAYIPGFSSPQAAGTLVIERVDFTASISAISAGGGTAARTILAGGQFV
ELFAQGNAWTTAGQALNGQVFNGTSCVYENASQTVYSAQETTIQRKLAPIPRPSNLVDSS
GAYVYRVKPQYEQLNWATDFISAKAFGLVGDGAADESVAMQNLFNTAAQQGKIVYFDKGA
YVVTTTILVPKDLKITGELLSIIMCRGPYFQDEFNPKVMWKIGNPGEVGTVELSDLIFET
QGPCAGAIMIEWNIKAAGPALAGMWDAHWRIGGTAGTQLQQNTCIKTPAIPIAPGHPKLS
ACIGAFLLLHITKEADGYFENTWGWVADHELDMDDREQIYIFNKAGFLIESENGPVWMYG
TASEHSVFYDYQFTNARNIFIGHVQHETAYFQGNPNALLPFTPQASWHDPTYEDCVQANC
ARTWALRFVNSSQIFLYGGGAYNFFENWNTQACLGTESCQERMVDIRNSSDIYLWALSTK
GSQFMISYEGTSIVPYSVNRANFCETIALFELAKDQ

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	2	750	2.2e-227	0.9283783783783783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.15e-66	2	224	16	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.22e-05	380	438	1	61	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH02598.1|GH55	1.47e-238	2	751	184	884
QUC19167.1|GH55	9.90e-238	2	751	44	743
APA10182.1|GH55	2.44e-234	2	751	181	878
UQC79154.1|GH55	4.24e-234	2	751	78	783
QLI64786.1|GH55	6.19e-233	2	750	83	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.17e-232	2	751	43	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	2.02e-174	2	747	64	752	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	8.07e-228	2	750	81	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	3.51e-150	2	747	85	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.41e-40	3	722	71	728	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KEF55219.1.