CAZyme Information: KEF54485.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF54485.1
• CAZy Family: GT8
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		33489.96	4.0025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000010:1014352-1015431(-)

Full Sequence      

MRSVALLLLGFSSAASTVRAQLQGFNYGATFEDGSCRLASDFVGTFNSAHNLAGTDGSFT
SARLYTTIQCGTTNEPISAIQAAIDTDTSLLLGLWASAGDTIFDNEIAALSSAVAQYGSA
FTDRIIGISVGSEDLYRSSPQGIANEAGVGVDSATIVRYINRVKDLASQTPLLQGKSIGH
VDTWTAWVLPENAPVANAVDWLGYNSFPYFEDTLPNSIEDAESVFFNALGATEGVSGGKP
VWVTETGWPHSGPTSNLAVASVENAQTYWSSVGCGLFGQRNIWWYTLSDANTAQTEISFG
VAGAGNPPSTTPIYDLSC

Enzyme Prediction     

No EC number prediction in KEF54485.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.27e-25	12	278	37	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.001	130	318	108	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD07209.1|GH17	2.20e-128	15	318	12	310
CBX92291.1|GH17	3.39e-125	15	318	12	310
UQC89650.1|GH17	9.47e-113	14	318	12	312
QQK48355.1|GH17	1.07e-110	8	318	6	309
BAE54624.1|GH17	5.30e-110	8	318	6	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.69e-21	24	304	39	284	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.55e-20	24	304	39	284	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	9.41e-111	8	318	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.26e-110	8	318	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	6.35e-110	8	318	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	7.19e-110	8	318	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	1.37e-102	8	318	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999698	CS pos: 20-21. Pr: 0.9460

TMHMM  Annotations     

There is no transmembrane helices in KEF54485.1.