CAZyme Information: KEF53794.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF53794.1
• CAZy Family: CBM32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	AMGV01000012|CGC2	33309.46	4.7375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000012:540705-541586(+)

Full Sequence      

MPPLPGFSDNPLQTREDVVRATEAFLKPLLKFFSPASARVRLPVGSGAHFDETAAQLEGF
ARPLWAIGAFLMAGEPDWNLVQPWIDGLETGSDPDHPEYWGAIKDHDQRMVEAEMVSFSL
LAAPRTLLWDKLSVRAQQNLVEWLQNMNDRQTHKANWLWFRVLANLALIRVAGVETTKIH
SQMEIDLAQLHTFYLGDGWSADGLWRSTDLDEEEWRIFSTTGRANSIPSGRNADFYSGSF
AIQFSQLLYVRFAGDMNPTLAERYRQQAREFGAGFWRFFDAEGRLTSFVDGDF

Enzyme Prediction     

No EC number prediction in KEF53794.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	14	285	5.4e-73	0.7040229885057471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401852	DUF2264	2.50e-96	14	284	1	245	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
226739	COG4289	2.44e-42	10	288	23	267	Uncharacterized protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93188.1|GH154	8.34e-127	1	288	1	288
UQC88798.1|GH154	4.83e-112	1	288	1	296
UPK95456.1|GH154	5.01e-106	1	288	1	296
CCT69844.1|GH154	7.41e-104	1	288	1	296
QGI82930.1|GH154	1.04e-103	1	288	1	296

PDB Hits     

KEF53794.1 has no PDB hit.

Swiss-Prot Hits     

KEF53794.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999942	0.000076

TMHMM  Annotations     

There is no transmembrane helices in KEF53794.1.