CAZyme Information: KEF53650.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF53650.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45083.74	6.3959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000012:126442-127650(+)

Full Sequence      

MRALFRISLLLALLLLLVILHSFYLFAGAQNPEQVATHFAYVFYATGDIYACSALVNIHR
LRHLFHTKYPVYLLASSAVSDTYKEWSREQYDVTIIEHEPPPLAGQSSPYYHDVLLKLVS
FNLLEWAPQLRRILVLDSDQIILKSLDDVFTQVPLNVEVAAAHAYWFSGDPGATTAMIMV
SLSAPLWARMDSSLKNITEDVYDMDLINSMFRGEMALLPGNYVTLNSHWETKELPSWTQY
RPVLPVQLPWNKTVSSTVQGSPPALLHHSKRKEAQNQTAATFPFSSAPNTLLPQSIPIAF
TTYDPATIDPLTSIFHEDVYVLHFTALGKPWTHTIQAVNTLRPQAHPLFAQQFLLWRMAA
RQICPVVDMHGAGGNTVGGKTGWPGLGLQDGELPSDRFLDDV

Enzyme Prediction     

No EC number prediction in KEF53650.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	33	334	4.2e-21	0.9066147859922179

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.15e-34	39	244	1	210	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	2.53e-08	40	213	2	199	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
227884	Gnt1	1.26e-05	21	150	42	188	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
279798	Glyco_transf_8	2.06e-05	34	162	23	130	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	0.004	42	162	3	127	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC16913.1|GT8	3.75e-53	28	371	37	317
QLI68178.1|GT8	7.74e-50	40	365	43	303
UPK95458.1|GT8	2.65e-35	40	237	10	203
QSS63276.1|GT8	1.50e-14	30	219	65	255
UQC91072.1|GT8	4.27e-14	28	219	86	282

PDB Hits     

KEF53650.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.44e-10	37	233	153	357	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000000

TMHMM  Annotations     

Start	End
7	29
39	58