CAZyme Information: KEF53475.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF53475.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	AMGV01000013|CGC2	65309.59	6.4541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000013:412295-414098(-)

Full Sequence      

MRLSQWTHFLSLPGWLRVACAEATSPNNHETPVYHGGLRDDQQSMLGLCPDYTNYARRRH
KPFSEGPLELPYQRPHPACRKFSSPAAEKVIDDLFPHFKDPDLAQLFRNAFPNTLDTTVL
WHVDGVKSQALPSRMLTRDRNIWKQDRAYSFIVTGDINAEWLRDSTNQLQQYQGLAKSAP
DIKALLLGAINTQAEFVIASPYCNAFQPPDSSRLPPVHSGQDDYVHPAYEPSIVFECKYE
LDSLANFLSLGNQYHAATGALDFLTARWYKALDSVLRVLEAQSTPTFDRETGRFEPNEYS
FSRSTRQGTETLNLGGNGNPLAGKTGLVRSAFRPSDDATTFGFLIPSNAMIVVELARTAD
VLEKAAKAESTPESDAKFIEQVAADLRRRSETIKEGIYNYAIAKHPEFGDVFAYEVDGYG
SHLLIDDANVPSLLSLPLLGFVSANDRVYQNTRRMILTQRGNPYYLSGPKFHGIGGPHIG
LRNAWPMSVLVQAMTSENDEEILDCLARVKNISVFGLINESVDVHRGVGSTGDGMTRSWF
AWANSVFARTVLWLAEEKPELLLKRKGRYVVGKGWTELDEAPRS

Enzyme Prediction     

No EC number prediction in KEF53475.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	100	552	5.3e-151	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	100	552	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.34e-138	78	566	1	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13217.1|GH125	1.21e-223	38	568	27	541
QRD90853.1|GH125	2.71e-219	37	562	23	526
QMW43832.1|GH125	2.71e-219	37	562	23	526
QMW31801.1|GH125	2.71e-219	37	562	23	526
UDD60757.1|GH125	2.71e-219	37	562	23	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	1.56e-86	74	562	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.29e-86	74	562	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	6.21e-85	74	562	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	6.64e-70	89	551	14	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	8.22e-70	89	551	14	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.86e-164	49	564	27	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.262485	0.737489	CS pos: 23-24. Pr: 0.3883

TMHMM  Annotations     

There is no transmembrane helices in KEF53475.1.