CAZyme Information: KEF52682.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF52682.1
• CAZy Family: AA4
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:A0A072NZ36]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	AMGV01000016|CGC2	73991.78	7.0805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000016:126101-128340(-)

Full Sequence      

MNKLMFFILSVCSLITHTVCFATWPSSVDELEDIKYLNDGYNSRGFAFAVTPCTFARAPG
RSIAGGFLRTAFHDMAPANVASGAGGVDGSIGFELQGQYASSNGGPAFNNTITYYSRFFN
AQASISDLIALGVYTAVRGCGGPVVSTRSGRIDATQAGALGVPDVRDPGPALQAHFIRMG
LTQPESISIVACGHSLGGVHSTEFPAIVPTNSTRLGVADFDSTNATYDNKIVTEYLSGST
KNPLVVGPDPSARSDLHLFNSDNNATISTLQDPVAYRSTCAKVLQKMIDTVPAGVKLTDP
IEVYPVKPSALQLNVLSAGDKLSFSGQVRVRINDMPKATISKVEIEYKDRDGSKSGTIVA
TPLGDASGFDDSFTFYGFESEISAKTAISGFNVLVTLTSGTVKTFDNNGKGFPVSDKIFP
QVINSSLSAPSGTGVQKLNIIAAVRNGQSPNDLKLTIGTINPMSYNNLPTISKSSVTLVK
SCESKYYTFYSASADAFTNQVNGTKYDVSFTSGGTTYLDSFNPINDLPRTANAPSCNGGG
GGGDDGGRTSTTSQSTKAATTSAARSSTSDSTSYTTTVVTRYTTFCPFPTQFTHGTKTFT
VTEATTLTITDCPCTIRMPWTSASTTATATATATASATLVATTIANVNPTSIPDSHNGQP
VAPSSTTPPGGSRTTTKPAVVATFTGAATEAKKADLLFVAAAGAIAYLM

Enzyme Prediction     

No EC number prediction in KEF52682.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	63	256	1.1e-19	0.7254901960784313

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	7.11e-108	24	289	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	3.87e-20	58	288	12	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.60e-14	61	200	13	155	Peroxidase.
173825	ascorbate_peroxidase	2.57e-11	67	273	33	218	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	1.16e-08	68	200	35	166	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ57066.1|AA0	2.25e-115	23	530	25	534
QGA18666.1|AA5_1	1.47e-111	23	509	24	513
VBB76056.1|AA0	2.72e-111	23	522	28	525
QRV94524.1|AA2	7.16e-94	23	530	21	531
QRW22025.1|AA2	1.53e-93	23	510	20	525

PDB Hits     

KEF52682.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.13e-118	23	530	22	511	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q01302|CCG6_NEUCR	5.92e-11	578	619	27	68	Clock-controlled protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccg-6 PE=2 SV=2
sp|P40092|SPI1_YEAST	5.98e-08	578	624	69	115	Uncharacterized cell wall protein SPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPI1 PE=2 SV=1
sp|Q6ZJJ1|APX4_ORYSJ	5.66e-06	68	264	35	226	Probable L-ascorbate peroxidase 4, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999719	CS pos: 22-23. Pr: 0.4875

TMHMM  Annotations     

There is no transmembrane helices in KEF52682.1.