CAZyme Information: KEF51562.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF51562.1
• CAZy Family: AA14
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	AMGV01000023|CGC1	92724.83	5.3064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000023:323405-326085(+)

Full Sequence      

MGSIAPDFTTYDDFHVDQVLAKLTPDEKISLISGSDPWHTAPIPRFHVPKIRLTDGPNGV
RGTKFFNGVPAACLPCGTALASTWDIELVRQGGALQGREAIAKGASVILGPTTNMQRSPL
GGRGFESFSEDPVLAGHISAATVCGIQSTGVAATIKHFVCNDQEHERQSVDCVVSERALR
EIYLMPFQIAERLARPKCYMTAYNKVNGLHASSSKELIQNVLREEWGFDGLVMSDWFGVY
SVVDSIKAGLDLEMPGPTYMRGQLVKHALGSGRLLAREVDARAKEVLKLVRSLLPLGIPE
DCPEEAVDTPETAALLRKIASNSLVLLKNVGKILPFSDSKTIGVIGPNAAFAAYCGGGSA
ALAPYYAVTPLDGVRARYKEDKVKYELGAPGWKKLPLLSQIARRSDFQPGFDAKVFLEAP
SSNVQRKPVDSFTVTTSDIFLADYKNDHIEGNLFYMEFDASFTPDETAEYEFSLSVSGTA
KLYVAGQCVVDNATNQTAGDSFFGSGTVEETGTIALQKGEKYPIHISFGTLPTRTYTVEG
ANPFGAGGLRAGGFRKIEIETELERAATLAKSVDQVLLCVGLNGDWESEGYDRSTMDLPA
GSDDLIRAVLQANSNTAVVVQSGTPVTLLPWAKDAPAIIQAWYGGNETGNAIADVVFGVT
NPSGKLPLSFPVRNEDNPAFLNYRSERGRTVYGEGVYIGYRFYERTKREVAFPFGHGLSY
TSFELSSLQLQIHESAEKARNDLDAVISVSVDVANTGLLPGAQVVQVYAAAQAASVGRPV
KELKGFTKVFLQSSERRRVSIEMSLKYVTSFWDEQAHAWVQEQGRYTLHVGDSSAHTPLT
VDFEVAETVWWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	255	1.6e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.96e-70	75	835	121	755	beta-glucosidase BglX.
224389	BglX	8.48e-64	43	349	55	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.21e-53	324	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.73e-38	74	289	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.35e-35	23	832	60	770	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR64317.1|GH3	0.0	11	854	5	836
SMR61167.1|GH3	0.0	11	854	5	836
SMY29662.1|GH3	0.0	11	854	5	836
SMQ55981.1|GH3	0.0	11	854	5	836
UJO24157.1|GH3	0.0	11	854	3	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.08e-260	14	854	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-254	14	854	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.50e-128	16	849	5	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.69e-122	23	834	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	6.91e-99	18	835	56	818	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	2.70e-305	16	854	6	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	5.43e-305	16	854	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	5.43e-305	16	854	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	5.04e-303	14	854	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	5.22e-303	16	854	6	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999894	0.000151

TMHMM  Annotations     

There is no transmembrane helices in KEF51562.1.