CAZyme Information: KEF51047.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF51047.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	AMGV01000031|CGC1	42900.70	9.2169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000031:40775-41993(+)

Full Sequence      

MDSPSQRGINALQQFYGNRKSLRWVVFLVIAALTTLYLTGQSYTPSSTGTHKASKSRAKY
LSPAKLLERPISKDLQTIPKLFHQSWSSNELPAKFERWSATCRRAHPDWEWVLWTDKDNE
ELVKTHFPWLLKTYKALPGVIYRADLVRNLYMHMFGGVYADLDVECLLPSDHLFKTYNVS
TVSHAKPRPLTTHDMHKSGRKAFFGRMGTDDSFDNSVPNAWMASTPGHPFFLLLVESVMK
QVAEGPENWSAEAITGPAKLFYTIGEYSEKEGKYSGELLDKHVAKNPAAKQFTPRKGLGH
AVEVLPFQYIYPYSWQRDGEAFRDFCWATKKSFNATKCKQLLATDRWPSYAITYWSHTWT
GEGHDEGNLAQIEQN

Enzyme Prediction     

No EC number prediction in KEF51047.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	97	174	6.7e-18	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.03e-29	27	269	37	245	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.56e-14	101	173	10	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO66576.1|GT32	5.04e-111	56	372	76	410
QLI72987.1|GT32	2.60e-90	25	374	15	360
UKZ71055.1|GT32	2.89e-87	58	374	77	372
ANH56535.1|GT32	5.55e-83	45	374	71	378
BCS29894.1|GT32	4.37e-66	62	359	72	380

PDB Hits     

KEF51047.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.30e-22	72	166	51	145	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.01e-19	76	249	60	200	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.72e-18	74	240	60	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	4.31e-18	78	240	82	215	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.51e-17	19	238	2	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000007

TMHMM  Annotations     

Start	End
21	43