CAZyme Information: KEF51007.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF51007.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	AMGV01000034|CGC1	73911.19	6.2812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000034:24501-26592(-)

Full Sequence      

MDFARDLKGSKTVDIGFRGVSLSTDPLGTILQISTFHPKHGIVIAEPYEQFDGTKFHDTP
YVREHRGRMLRSVQSGSPGFGLRFETEVKSLVVNQHGLGRATIVYGTKSGLEITTSLRVS
EDGRIFQSSQIKSTKAYPISLTYSIDFGISINRASYGQLTEGGPIPIPNSENRIEVLDAG
SVFTVTNPNLGAHLLGHFEINGEEVYVGAHLSNQTYIQSPAKGKISQSAVVVPESTFELV
ATFELRPGRYTTSKVDRHSSVLDLRGAPSLWSTPETPGRFIVRRNLEYILGNCAIPLSHE
GNAVCILTDHVALPLGWMRDNYWQVRFLMEVYQNLGSLDGMNAMSLYSHQIKDTAKGHLN
WIFRHAQRPHGFWHRSYLTTGRPKDGPVFQLDQQCYPLLELCDFWDTFPDETYFVEGIIT
EGLVCQILDLIESKEDKSTGLFSTDETPGDDAVEFPFHFSSHILLWHTASRLSKVSSQRS
LGTQTSVRSDALAKRVRTSAMKYFLTQESEVGPSLFAYLVDGKGGKTFYHDANDIPTLFA
STWGFVKTDLEEQAWHNTMDFGCSLANEGGYYPEGPFGGLGSVHTRGPWTLGYFQSWRYA
QMTGDAQAESTAWQKILGVMLWDGTFSEAVDAQTGECTSKAWFSWPGSMIGAGLLQLGNK
ERYL

Enzyme Prediction     

No EC number prediction in KEF51007.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	437	652	4.2e-19	0.5223880597014925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226068	COG3538	4.38e-11	448	657	218	422	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
399660	Glyco_hydro_125	6.43e-08	448	651	214	412	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ96911.1|GH0	1.69e-211	8	655	25	672
QYS95269.1|GH0	2.71e-204	8	655	25	672
QRC90923.1|GH0	3.45e-196	5	657	25	677
UKZ83339.1|GH0	5.07e-170	8	655	25	561
UKZ57633.1|GH125	2.66e-157	8	635	25	541

PDB Hits     

KEF51007.1 has no PDB hit.

Swiss-Prot Hits     

KEF51007.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KEF51007.1.