CAZyme Information: KEF50834.1

Basic Information

• Species: Exophiala aquamarina
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Exophiala; Exophiala aquamarina
• CAZyme ID: KEF50834.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39740.14	6.6822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EaquamarinaCBS119918	13118	1182545	0	13118

• Gene Location: location=AMGV01000070:6719-7765(-)

Full Sequence      

MVLRPAPRYILFTIVLVVCVLVSCHSFGRHYSPGPLSTPSSVGRPAHVHPVELVHDHEYR
DTCTFTDSEEDFLIVVKTGANEIHDKLPTQLLTGLRCYHDILIFSDLEENIGPFNVHDAL
KNVSSAIQARSPEFEYYRQLRDYRENNLDISSLRGKSHSAAWKLDKFKFIPMLEETWKMR
PHRKWYIFIEADTYLVRTNLLLWLARQDPSQLIYFGSPTYFHGEEFAHGGSGVVLSGAAL
SRFVEGDGGSTARYDDLLQSETFGDYILMKALRVNGVTLSSRWPMLQGEKPSTIPFGPGP
DNGVRHWCQPILTMHHITPEEACAFWDFEQKRNSPSVRHHLPESTWAV

Enzyme Prediction     

No EC number prediction in KEF50834.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.002	183	240	85	157	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.003	181	246	209	283	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD58664.1|GT31	3.86e-105	74	335	64	324
QMW41467.1|GT31	5.07e-105	74	335	73	333
QMW29395.1|GT31	5.07e-105	74	335	73	333
QRD85744.1|GT31	5.07e-105	74	335	73	333
BAE59144.1|GT31	5.07e-105	74	335	73	333

PDB Hits     

KEF50834.1 has no PDB hit.

Swiss-Prot Hits     

KEF50834.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.093833	0.906150	CS pos: 26-27. Pr: 0.3800

TMHMM  Annotations     

Start	End
7	29