CAZyme Information: KDQ34234.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ34234.1
• CAZy Family: PL8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	KL198004|CGC17	39910.52	8.0320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:4784315-4785701(-)

Full Sequence      

MIIAGKSTAVAFTFFAALIVAAAPDRQLCGDAENIADKIPSCKVTAPPGPFQPPSFNVSK
WIWTGENPVPGGVNPVGVRAFRKNIVTPCGKCAVHATIIVASDNTHVFYVNGVEIGAGAG
WTKGQVLYATLRPSSNLFAIAGGNIPPGGPAGVIASILIHYADGSTETFITDETWRTVAS
AAPPKDFQLPATDDSKWGFAALQGIYAKTRWGAVALPPVLGFNDSKWIWSSDHKNGAAPK
GVRAFRKTVNECAKVAVSATVLIIVDDSYTLYVNGEKVGAGNSYTRSQAWTILNLHPTFN
TFAISAGNIGGPAGVLATILITYNDGSNQTVVTDGSWKAIQTVPKGFELPFVNEAEWEDA
KVVGPFGVGPWGKGVVIPLA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM67	225	371	8.4e-35	0.9943181818181818
CBM67	59	211	6.1e-30	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400715	Bac_rhamnosid_N	2.88e-08	96	197	6	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
400715	Bac_rhamnosid_N	9.19e-06	269	378	16	162	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZM69083.1|CBM67	8.61e-267	9	380	5	376
AZM69082.1|CBM67	3.86e-172	17	380	16	373
ADT89769.1|CBM67	3.86e-172	17	380	16	373
APD76300.1|CBM67	1.17e-162	9	380	4	377
AZM69085.1|CBM67	1.17e-150	15	380	14	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KBJ_A	1.33e-173	17	380	16	373	Structure of Lectin from Pleurotus ostreatus in complex with malonate [Pleurotus ostreatus],6KBQ_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Glycerol [Pleurotus ostreatus],6KC2_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Rhamnose [Pleurotus ostreatus],6LI7_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with GalNAc [Pleurotus ostreatus],6LIK_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Galactose [Pleurotus ostreatus]
6T0Q_A	2.91e-170	22	380	1	353	Pleurotus Ostreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	9.26e-170	23	380	5	356	Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]
3W5M_A	3.96e-16	204	380	111	299	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	2.03e-15	204	380	111	299	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999707	CS pos: 22-23. Pr: 0.9598

TMHMM  Annotations     

There is no transmembrane helices in KDQ34234.1.